LOCUS Theralytix Phi11 38966 bp DNA linear UNK DEFINITION Theralytix Pseudomonas aeruginosa Phage Phi11 ACCESSION Theralytix Phi11 KEYWORDS . SOURCE Theralytix Pseudomonas aeruginosa Phage Phi11. ORGANISM Theralytix Pseudomonas aeruginosa Phage Phi11 Virus. FEATURES Location/Qualifiers source 1..38966 /mol_type="genomic DNA" /db_xref="taxon:6666666" /genome_md5="" /project="Theralytix Phi11" /genome_id="Theralytix Phi11" /organism="Theralytix Pseudomonas aeruginosa Phage Phi11" CDS complement(60..599) /db_xref="SEED:fig|Theralytix Phi11.peg.1" /translation="MTNAISKTVIAFRGTEEINRAIDAIRVRGKELDEAIQLTGLSII HHIDQCGDVTVVKALYEAMPKGSRRNALVEWLVLHGKVQVNTDKKSNKDLPFLYNKFG KTDLVGATNSPWYSFKPEKALDQEFNLAAALATIKKQVLQAQTKGKVIVGMELLGDLE ALAAKAAPIAEQSKRAAAH" /product="Phage protein p03" /transl_table=11 CDS complement(610..837) /db_xref="SEED:fig|Theralytix Phi11.peg.2" /translation="MPRVNELTPRQRKAAKARRDKARRIDLAHKMPKGADCPIFRKAE QAQAKQPRVDTLTTPRSAGYLAAAAYLNKSI" /product="Phage protein p02" /transl_table=11 CDS complement(837..1121) /db_xref="SEED:fig|Theralytix Phi11.peg.3" /translation="MAHFKAKAPKSPFAAQVAYWRDWEAKRTKLIAQDNVEGRKELRK MRDVRYATDPEPAPGRYHNPEQKAFVKGSEGKARNILKGWNAKKSQGKGL" /product="Phage protein p01" /transl_table=11 CDS complement(1736..1957) /db_xref="SEED:fig|Theralytix Phi11.peg.4" /translation="MGGRSVEFALSSRNTASTGSLETGLTHYQGIGRVRSQNDGRLQP SKRGTSHRRKGHGKLLGQEPQCVRPAGIT" /product="Phage protein" /transl_table=11 CDS 2543..2755 /db_xref="SEED:fig|Theralytix Phi11.peg.5" /translation="MLSRQDRGERAWHQRDAAWQRKLARWATEDEQHSPYPAARARAR EDRRLALVAHRRALGMSRWAATPPQG" /product="hypothetical protein" /transl_table=11 CDS 2844..3050 /db_xref="SEED:fig|Theralytix Phi11.peg.6" /translation="MAHQTRAYGGRVGVSESGGFSHDDIKIGPGVTTPAHTSQPSPHT PSIKIPVVPVEHPTMQVLGLNYYA" /product="hypothetical protein" /transl_table=11 CDS complement(3041..3235) /db_xref="SEED:fig|Theralytix Phi11.peg.7" /translation="MATFAAATQKDLRAFAGTIENLIRPLEEAALGSGYNGTKLRTEY VPHLDELMAAVETAKAKVYA" /product="Phage protein p48" /transl_table=11 CDS complement(3285..3599) /db_xref="SEED:fig|Theralytix Phi11.peg.8" /translation="MANTREQYLAGRNTGLTFYQVCQPGTDNRIALHDMDEADVKAKA TAVIAAATALGGEGGATPPDPLTAYKVKNGDTLPVDGGGSVKVTVANGAITKVVYTAP AG" /product="Phage protein p47" /transl_table=11 CDS complement(3601..3714) /db_xref="SEED:fig|Theralytix Phi11.peg.9" /translation="MLCEHPLIDPTTQAGLIRAVAAYQDALDLCNALNQGD" /product="hypothetical protein" /transl_table=11 CDS complement(3689..3982) /db_xref="SEED:fig|Theralytix Phi11.peg.10" /translation="MVALGASYGFVQSYRALGIAQEEIKRQTARAEALEVRYATLQRH VKEVAARTNTQRQEVDRALDQNRPWADRPVPAAVVDSLCDRPGARCAVRTPTD" /product="Putative phage-encoded lipoprotein p46" /transl_table=11 CDS complement(3976..4458) /db_xref="SEED:fig|Theralytix Phi11.peg.11" /translation="MNKPLRGAALAAALAGLVALEGSETTAYRDIAGVPTICSGTTAG VKMGDKATPEQCYQMTIKDFQRFERIVLDAIKVPLNVNEQTALTFFCYNVGPVCTTST AFKRFNQGRATEGCQALAMWNKVTINGQKVVSKGLVNRRNAEIKQCLEPSSQYSSLLW " /product="Phage endolysin" /transl_table=11 CDS complement(4455..4655) /db_xref="SEED:fig|Theralytix Phi11.peg.12" /translation="MMLDTATEAGKGTLAVTGVGIAVYSPYEIASLCAAVLTALYVGA QLITLLPKMLDSIAELRRRFKK" /product="Phage protein p44" /transl_table=11 CDS complement(4652..6457) /db_xref="SEED:fig|Theralytix Phi11.peg.13" /translation="MTPQERFQIAHEVRDMYPRFRDFCLDAMLFLGFKMTWMQLDIAD FMQDSPNKAMVAAQRGEAKSTIACIYVVWCITQNPATRAMLVSGSGDKAEENGQLITK LIMHWDLLAYLRPEARMGDRTSATSFDVNWALKGVEKSASINCIGITAALQGYRADIL IPDDIETTKNGLTATERAKLTRQSQEFTSICTHGKILYLGTPQSRESIYNGLPARGFL MRIWPGRFPTLDEQERYGDWLAPSILARIARLEERGHNPRTGKGLDGTRGWAADPQRY NEEDLLDKELDQGPEGFQLQYMLDTSLADEQRMQLKLRDLLFIDATHESVPEQVAWAA DERFKLKFDAHRFPVIKPELYLPALMAGGWAPLQQMTMFVDPAGDGGDELSYAVGGTL GPYIHVVSIGGWKGGFAEENLEKCIALAARYGVKVIYVEKNLGAGAVGQLFRNHIRSI DPDTGKPRYEGIGVEDRQKSGQKERRIIDTLRPIMQRHRLIFHVSAMDSDHVSCQQYP ADKRNERSVFHQIHNITTDRGSLPKDDRIDALEGLVRELAPTLVKDDEAATRAREEAA KKEWLNNPMGYTKSVLRSLGMGRERRKGRPKGRRL" /product="Phage terminase large subunit Gp19, DNA packaging" /transl_table=11 CDS complement(6466..6771) /db_xref="SEED:fig|Theralytix Phi11.peg.14" /translation="MSKKQTASAERLGLLHELVCTAIERNFKWYMDNDIPIPASDIAA ATKFLKDNEITCDPSDTINIDRLREEMRQAQAENRRIALEGFIAGETDDEMERLYTH" /product="Phage terminase small subunit Gp18, DNA packaging" /transl_table=11 CDS complement(6771..7376) /db_xref="SEED:fig|Theralytix Phi11.peg.15" /translation="MALIYDFNLDLDPKAKSKFVGARGRRDISDVLDFCDGGVAIQDP SQGMLVRVWRTELRQDGTYLGYEDGSNEIRIGGGIEDGISTMSLDFDSNMNYVCAFVR ADRTGAISYFNVQQGRRLLVELGQVDYAKVALDDKRPGATAWAQVIVPYTRNGNLYVR TQNENYTEEHLEVDTGKVFRPLVKCGMGTNLRFQVQFRGHM" /product="Phage protein p41" /transl_table=11 CDS complement(7380..8288) /db_xref="SEED:fig|Theralytix Phi11.peg.16" /translation="MFKTRVKGRYTVTHLKATGEVLAQYTFDNLITNAGLDWICAMDT SDLFSQALAVSTSTADPNPAAPSLPEEVRRTTSYAPNGDVTSGLDGEWIYWHKRWRFP IGTLAGQVLATVGIVARSEVGFESNTGAKIPAGTPLSYTRIKDSAGQPTTLVVQADEI LDVQYELRSKAVTMAEAKFVIAGVERTIRLTPLPFANRRNLYGERYIFYNESPRIHGK SASGSDVQDGQWTKLYPRYVRGSYKGQLMLRATVDNGNMPGGITGCKDLKIYNGRNYA LTIDPPVVKNNTQEFSITMEFSVARA" /product="Phage protein p40" /transl_table=11 CDS complement(8281..8739) /db_xref="SEED:fig|Theralytix Phi11.peg.17" /translation="MRGIIAGIMASQIRRPKPILATYPYPILATDDTWSCQANIVAAL TRDTLHEVVNQPGEDTYQASAGVVEVLLRSLTQLGYGGGDGFLTGPAIHAALLRDTVK GYNAEPYAFLSQTAVVGAELKVVVVYSEYIVEPYAFATTTAIKQAELTNV" /product="Phage protein p39" /transl_table=11 CDS complement(8739..9494) /db_xref="SEED:fig|Theralytix Phi11.peg.18" /translation="MARFKNPETIHVADGVEAVFSLDFPFLRREDVFVQVDKILTTDY TWVDNTNIQLAVVPKKDQEVRIFRDTPAQVPDTQFSQGIPFLPRYIDANNKQLLYAVQ EGINTANLALDGVLDAIRIAEEARRLAQDALDAANEALRRALGFAEIRTITEDTDISK EWRGYWNRCMTADKPITVTMQMEDPDDPWIEFSEVHFEQAGVRDLNIVAGPGVTINRL QNTTMQLYGENGVCTLKRLGPNHWVVFGAMEDE" /product="Phage non-contractile tail fiber protein Gp17" /transl_table=11 CDS complement(9496..13509) /db_xref="SEED:fig|Theralytix Phi11.peg.19" /translation="MAKQFKGRMTPKYPLDQAQLDEAQVQGQLDAVPTVGFDALTGGE IGERNVAAGQRANARELERIVADQELPALDRASALWNQSTLVGRWGDALQLDADLAAN STGEVDPNFDAGTYGVQALQAAGIQPTDNYLQIMARAGNAKDAAYLLSRIQRYEQDEQ IVRDNPYWNFAAGMLDPAALAVDAVTFGAGRALRLGRAGMAAAGGAGQVGYVAGLDAA GADVDAGTYIVAGALGAGVGALLGSGAGRIAAEAPTQPHVPEVSAPTVGLPEVAMTAE EAAARGFKAGDVVDLLDEGTVLSRISARVEQAEIPAIPRRDTAFGDELHSLSGRKLSE VVDHLKTHAEVPKPLQGIAAKVADTLKTLEGLGQRTAFRVVQGGDTASSAFLKPGTAG LHSTQGLDTLVQVRGSTAPGRVGTNPVTVLHEAVHAATVGVMNAALRNPGAMSPKVAQ AMQTLENVRGNVLNALKQDRAAGRQLSEFEETLLAGNSNTLANVKELVAWGLTDTRFQ RTLNRLRYSDGGPGLWSRFVEGIRSLLGLRSDADTALSRVLAASETIMDAMPGYTKAQ AKWANKGAPVTEEASLETIVQSTRERAREGAGFVNRFFSEADLLAQPGEGARRLLGRL IDDPVRRDGFSTNDNAASYLRRYRNEFEGYVKSYDEMMAKAMAEQGVGLTARALNSRR AMAVRDQLNEQVTRELLRRDREWTAYGSVRVDPNLPPTIKALADRSDEIHGLMGRRAR EAGVRGFEDFAPRPGYFHRSWNWSKMAQMDEAAPGLARRAISEAVFRGIPGLDRADAD TIAQAIVQRARDRATGIRSEFMGAMGVADTAFIRQALEEANVSQAKFDSIMAKIEQKQ SDQGTVKYGKGRLSLDMTAEINHNGTVYRVQDLIDRDLDRLMENYAGSMSGRSALARA GMPGDSEIEAFIREYQREAAHLGTDKVQELTGQLRGVFGDFTGNVPREHQLGPVAQRA SGLTSATMLGFSGVYQLAELATMAHRQGVFNVMKAMLNSRMGDFVGAMRRNPDLADEM QTVLGLNLANDIRMKPWKRQFDTFLASQDTFMDRFLHAGKQAVPVLNGMKFIHNWQSR MNANLTLNKVARAAQGDEAALRVLQQYGKDVDWTPVLARVRGYVTYRGRNAQSMNWGA WSQADVNTVMNTALRIMDDSLLYGRVGQNSGFARSPVGQILGQFRSFVAFAHNKLLRG TYENSGVLGVASLLAFQYPLTALMMGAKAAINGKFDTSDEGIRKMAIDGIGYTAGLGF TADMWGVVTGHSRMSAPVFGLAEHSNEVFRGVKDLVTGDDPAAATGDIVSGAAGALPF VNVFPATKLLLESIKGE" /product="Phage DNA ejectosome component Gp16, peptidoglycan lytic exotransglycosylase (EC 4.2.2.n1)" /transl_table=11 CDS complement(13513..16209) /db_xref="SEED:fig|Theralytix Phi11.peg.20" /translation="MAESQRASQELGINVGQTQLQPGQSARRGVRDSEVNYSGPSVGS QILDGILGAGQQIAGKWFEHNVQQEVLRGERARMAGEAEEAVDSNVLAKPFVKGGWRK QDYRIAQADFSLKMQRFIANKGREMTPEEFRKYLSQEATHVLDSTEGMNPNDALQALA QQQKAEEQLFGMQAKAYMDWSIDQAARGFRTQGNSILAKAVQAQATGDELSRQLSLEE AGLFYTNIMTSEDIPLEVRDKVGMQFLAASLDMNQRGIYEGLRDAGFLDSMSFDDRRA LNGLYEKSKAQTRAKESMATLRADADFQQRVANGAITDLAEVEAYSRGMVEEGRWSDA QAISFMTKAMTGLGNAQRMQGIMAALEAGDINALHTLGTNVTEALEQWDKMQAANGSS LTDRLVQGTQLGLRLGTFPKTYGESVGSAVRMIQAAKEGEANPELVNTLNSIFEQVAS AQEINPSAGNVMLSGIPEAEQGAVAWALKQMKMGIAPAQALREFSANAEVVKQMDEFE KGQNTKAFKDNLGKQVNDKFVNNIFGRAWNMLTGESDLSNNEAVLSMYRRATIDEANW LASDRKHAGLLTSDTGREALLEIAAANVRNRTIQVGEGRNLKEGDLFSRRDSAPLILP RGTTAEQLFGTNDTETIGTVLAEQHKPHVEGLLGYKSVVAFEYDRTSGSLLAVEYDEN GVALDRTRVDPQAVGKEVLKRNADKLNAMRGAEYGANVKVSGTDIRMNGGNSAGMLKQ DVFNWRKELAQFEAYRGEAYKDADGYSVGLGHYLGSGNAGAGTTVTPEQAAQWFAEDT DRALDQGVRLADELGVTNNASILGLAGMAFQMGEGRARQFRNTFQAIKDRNKEAFEAG VRNSKWYTQTPNRAEAFIKRMAPHFDTPSQIGVDWYSAATAE" /product="Phage baseplate hub structural protein / Phage lysozyme R (EC 3.2.1.17)" /EC_number="3.2.1.17" /transl_table=11 CDS complement(16209..16754) /db_xref="SEED:fig|Theralytix Phi11.peg.21" /translation="MAFWLPLLAAGGMSALQQGLANKEERNKIKAENKARLKTDLDNL GAAARDIANLGVMAASYRKQAVASQVEAKRQGMLAGGSAEAQAGAFGVKGASVDAVAL DIEREVGEALIQIDDNLDNQMWNLAEQAHSIQAQAKAGLLGQKSTTAGQRSPLVAGLM SAGSLYASQYFKFGATPKGGN" /product="Phage protein p35" /transl_table=11 CDS complement(16754..18535) /db_xref="SEED:fig|Theralytix Phi11.peg.22" /translation="MDPDANAATIAGYLNQRGVQDGYIAFRGDADIHVEVSTDMGNNY GIASGGMSLNATADLPALLPGVGAPGVGVQFMDGAVMATGSTKAPVYFEWDSANRRWA ERAAYGTDWVLKKMPLALRWDEATDTYSLNELEYDRRGSGDEDTNPTFNFVTRGITGM TTFQGRLVLLSQEYVCMSASNNPHRWFKKSAAALNDDDPIEIAAQGSLTEPYEHAVTF NKDLIVFAKKYQAVVPGGGIVTPRTAVISITTQYDLDTRAAPAVTGRSVYFAAERALG FMGLHEMAPSPSTDSHYVAEDVTSHIPSYMPGPAEYIQAAASSGYLVFGTSTADEMIC HQYLWQGNEKVQNAFHRWTLRHQIIGAYFTGDNLMVLIQKGQEIALGRMHLNSLPARE GLQYPKYDYWRRIEATVDGELELTKQHWDLIKDASAVYQLQPVAGAYMERTHLGVKRE TNTKVFLDVPEAVVGAVYVVGCEFWSKVEFTPPVLRDHNGLPMTSTRAVLHRYNVNFG WTGEFLWRISDTARPNQPWYDTTPLRLFSRQLNAGEPLVDSAVVPLPARVAMATSKFE LSCHSPYDMNVRAVEYNFKSNQTYRRV" /product="Phage non-contractile tail tubular protein Gp12" /transl_table=11 CDS complement(18619..19233) /db_xref="SEED:fig|Theralytix Phi11.peg.23" /translation="MSYKQSAYPNLLMGVSQQVPFERLPGQLSEQINMVSDPVSGLRR RSGIELMAHLLHTDQPWPRPFLYHTNLGGRSIAMLVAQHRGELYLFDERDGRLLMGQP LVHDYLKANDYRQLRAATVADDLFIANLSVKPEADRTDIKGVDPNKAGWLYIKAGQYS KAFSMTIKVKDNATGTTYSHTATYVTPDNASTNPNLARRHSKRA" /product="Phage non-contractile tail tubular protein Gp12" /transl_table=11 CDS complement(19236..19790) /db_xref="SEED:fig|Theralytix Phi11.peg.24" /translation="MLLLDAVNVILRKIGELPTLSMDETYPTMAIALPELEDQRIQLL TQGWWFNTWWRHKLTPDPTGRINLPKGTLAFYPDSPDLQWDGLGVRDANTGDDRIGKP VEGRLVLSREWDHIPEIAQRVIAHQAALAVYTHEIGPDETAQVIAQELQAYQNELSRM HTRSRPLNTQAKRSFSRWRRSLRT" /product="Phage non-contractile tail tubular protein Gp11" /transl_table=11 CDS complement(19887..20894) /db_xref="SEED:fig|Theralytix Phi11.peg.25" /translation="MSFLNDLTRPNYAGKNADVDIHLEEHLGIVDKHFAYTSKFAPLM NIRDLRGSNVVRLDRLGNVEAKGRRAGEELERSRVVNDKWNLTVDTLLYLRHQFDHQD EWTQSFDMRKEVAELDGQELARKFDQACLIQVIKAAAMDAPVDLEDAFSPGVLEKLDL TGLTAKQAADKIVRMHRRVVETFIDRDLGDAVYSEGLTPMSPRVFSLLLEHDKLMNVE YQATGATNDYVKSRVAILNGVKVLETPRFATKAIAAHPLGRHFNVSAEESERQIALFL PSKTLITAQVAPVQAKLWEDNEKFSWVLDTFQMYNIGARRPDTAGAIELKGIGAFDIT A" /product="Phage major capsid protein Gp10A" /transl_table=11 CDS complement(20947..21915) /db_xref="SEED:fig|Theralytix Phi11.peg.26" /translation="MTQPNEQQLPPGLANLVANIPPAAAPTPNHVQVMPNPVIQQQAP VQPGQVGAPQQLAIPTQQPQPVPTSAMTPHYQPVAVPAAGQPVVPQAPAQPAPVAPPA AGAVLPENLEVPPPPAFTPNGEIVGTLAGNLEGDPQLAPSISYLEAFSDKLDTVRAFG KAAENRDPRFIDEHYLKEVLGPAQAQHVINVAKGVLTYVDAQTKAVLNQTYAAVGGEA VLKQAAGVFNQHADPATKAAIGRLMDSGDAQAMQYAAKQIIAFAQGSGAVVQAAGQPL GAAAPALAALSAEQYRAEVSKLPLNASEADMAALRERRKAGMAQGI" /product="Phage capsid assembly scaffolding protein p31" /transl_table=11 CDS complement(21919..23451) /db_xref="SEED:fig|Theralytix Phi11.peg.27" /translation="MKTTAAMLWEKLRDGSVEQRAIEFAKTTLPYLMVDPMSGSRGVV EHDFQSAGALLVNNLAAKLARSLFPTGIPFFRSELTDAIRREADSRDTDITEVTAALA RVDRKATQRLFQNASLAVLTQVIKLLIVTGNALLYRDSDAATVVAWSLRSYAVRRDAT GRWMDIVLKQRYKSKDLDEEYKQDLMRAGRNLSGSGSVDLYTHVQRKKGTAMEYAELY HEIDGVRVGKEGRWPIHLCPYIVPTWNLAPGEHYGRGHVEDYIGDFAKLSLLSEKLGL YELESLEVLNLVDEAKGAVVDDYQDAEMGDYVPGGAEAVRAYERGDYNKMAAIQQSLQ AVVVRLNQAFMYGANQRDAERVTAEEVRITAEEAENTLGGTYSLLAENLQSPLAYVCL SEVDDALLQGLITKQHKPAIETGLPALSRSAAVQSMLNASQVIAGLAPIAQLDPRISL PKMMDTIWAAFSVDTSQFYKSADELQAEAEQQRQQAAQAQAAQETLLEGASDMTNALA GV" /product="Phage collar, head-to-tail connector protein Gp8" /transl_table=11 CDS complement(23463..23738) /db_xref="SEED:fig|Theralytix Phi11.peg.28" /translation="MLGKTIIGKLADGLLGTDLSGAQDDARRMEEQNRLMQQQADQLA RNQQVDLTAENVAQVDLGAMADATGTGTRRRRNQAGTGVSQTLGINY" /product="Phage structural protein p29" /transl_table=11 CDS complement(23704..24177) /db_xref="SEED:fig|Theralytix Phi11.peg.29" /translation="MTKSIWRVHAKAGAPSELMGLCWLAVQELEEFTLFRSKEEALEA MLDSIEGNDRTELLVFRDGQLAGGACIVFEDDPHVGPCVTAQWQYVLPRYRNTGVARE FIRELHRQAGWGQIPLVCWSHRESDSRYTIHYRRAKPYGQESKEGAGQDHHRQTR" /product="Phage protein p28" /transl_table=11 CDS complement(24177..24428) /db_xref="SEED:fig|Theralytix Phi11.peg.30" /translation="MATMKTHRPTVMSPTVEGSRTGKGTARPVTFTSQQIEWLEQTFP EHKISPGTTMEDIQFQAGRRDVVRAVRLRRRDAIAVELR" /product="Phage protein p27" /transl_table=11 CDS complement(24601..27048) /db_xref="SEED:fig|Theralytix Phi11.peg.31" /translation="MDLIQQQIAHEEALVGAAQNDARIALEKAIAQGSIDRIPRARIM LMRMLPIVTEAIFAHQEAKAAGPAAKLRHLLRIIDAQDLAVMALRAGLSMLINYPTIT ATKYYTHMGKMLCREIEVRLAFKVNQPYYDRTLDYLKTSRTRSVRHIQKTMDALLDAV LPEEARIDLPDGDYLRLGKFIGDPLIQCGLFEPNRFTGRGGTSVHLEPSPEAKEFLQD PSAAMTWGGPGRSVMLAPPRPWNDWCDGGYYSAKAQKHHVLVRRTKHQTKRARQMQLR HLGRDKMPRVYEAVNALQSVAYEINHDVYEIIERVFTSGGGVLGIPQRTYPDKPEFPL GDEWAKENASEQELEAFNRWKRSVHRWYTGEREHTAKLREFAALYRVVREHHGKAVYF PMHVDSRGRMYYWGTPNPQGSDIAKACLRFHEKRALGKRGLYWLKVHVANSLGCDKVY FDDRAAWVDERWDDFQRALDEGPENYPGLFPEDESPLCAIAGLLELRAAYASGQPERY QSGFIVHMDATCSGLQHYSAILRDEVGGAYVNLLPPGLTKADIYSRVLALVAGSLARD REGAEGEARGYAVLWDKAGLSRSLTKKPCMTLVYGTTFKGVVDHCLDYLDEAGLEIPE GIPSYRLGSYMATLILDAIRETVPSAVFAMEWLQRLAKALPDASKDLHWTTPLGMQVF QSYPKTEEVRVRLRAEAVEYVTLYEAKDELDPVRNANGIAPNFVHGLDSSHLGLTALA CAAEGIPIQAIHDSMGTYAADVDRMHVHIREQFIAMYSGPCVLVELAKQLGIEATPPR RGSLNLEAVRDSWAFFC" /product="Phage DNA-directed RNA polymerase (EC 2.7.7.6)" /EC_number="2.7.7.6" /transl_table=11 CDS complement(27057..27407) /db_xref="SEED:fig|Theralytix Phi11.peg.32" /translation="MSKICWCTRPHETDEGVRVIWAFNERGIGVNYVTAYITPAMVSH RDWGDVILPDILRGMAERLEREVKLVELRWFRAEILSCGEWRDYRAMTLDGAVSLAEA EWGPEDIGRVIERR" /product="Phage protein" /transl_table=11 CDS complement(27400..27771) /db_xref="SEED:fig|Theralytix Phi11.peg.33" /translation="MSLAFPDSYESTITTEPYRKGASLEERKVGKLPMHLVVEGFPLL KRELARMMQWAAEVKGYLPHDWKKMTVGEFKSAQHRHESKRLIDGPLDDESNLMHLVH EAFNAMAAAERALMDREKGNE" /product="Phage protein p25" /transl_table=11 CDS complement(27781..28827) /db_xref="SEED:fig|Theralytix Phi11.peg.34" /translation="MSKLRKQFTNEYLRNVYVELGLKKGAEHLTRHSRFGEVSRQCFR NWCIKLGFHDSRARGTYAKKGALHWLGRKAAEVVRKFPGAVGNVVGQGPKVLSLDIET SPIEGWVWSLWKQNVGLNQIKRDWTILSFCAKWMHSDEVIYMDCQGDPLDDMHLLVAL HKLLDEADIIIVQNGKRFDVPKINARFFLNKMPPPRPFKVIDTLIIAKQQFAFTSRKL EYMTHKACTIKKRLHGKFPGFDLWAACLQDNPEAWEEMRLYNIDDVRSMEELYILMRP WFVGHPNVAVYFNDAEPTIRCPKCGDTDVKQEGWVHTQTGKYEHYHCGGCGGWSRGRY TRNTSEQRKALLSN" /product="Phage exonuclease" /transl_table=11 CDS complement(28824..29264) /db_xref="SEED:fig|Theralytix Phi11.peg.35" /translation="MTSEPKVYQIPRSQQRTFTLKLWAEQGKLCPLCGKPIDISVKGE AVMDHDHETGLVRGVLHRSCNTAEGKITNAAGSWGCKSMKYTDIIPYLRALLTYLEGP KHPLIYPLHKTDEEKHEAKLAKRRQAAAKRKAAMAVAKHNARNV" /product="Phage endonuclease" /transl_table=11 CDS complement(29254..30195) /db_xref="SEED:fig|Theralytix Phi11.peg.36" /translation="MRLPSEEFLAGLSEQFDRTMAGGTLVCDADGPAYVASATAKTLD TALRRFWKIILEQQFLAHCTGTRVHLTAAGGAKAYRDVYPTMKPYQGQRKGKAKPTLL EPLRRAVADVHERGGAPEGIDVILHTFFEADDGMMMDAYAMQDKAIIRSDDKDLRMTI YPYWEIDTACVSRIDGGFGYLKEAYTPSGQFKLKGHGRKFFLAQWLGGDTADNIRGID RFNGKLCGMKTAFDILHPITDEDEAIDMILESYAKIKQNPLAEAEVLWMRRTPTDNAA QYLLSRDLRPAFRQWIIELDAYHEALLQKRRESDYDE" /product="Phage exonuclease (EC 3.1.11.3)" /EC_number="3.1.11.3" /transl_table=11 CDS complement(30195..31244) /db_xref="SEED:fig|Theralytix Phi11.peg.37" /translation="MTQQLNALQAALALANKAAETATIDMSETSTGGGGGRIFPAGTA MGRFCIYIELGDHAKEFQGKLKNPAPQIRLGFALWGDVNPQAGNPQSRPDDLFHTYEA DGSIKPGLFRTFEMTLGNNEKSKTKLAFDKMNWSGQHTHFAQMLGQAFIIPIKRTKIT KGNNAGKERNDIDWGGIMKPYNPVDGSPYNVPELPMDLLQYFFFDAPTKETWDALHIE GTSDNGKSKNFLQETIRSATNFPGSALHIMLGGGDDLIIKPTSQAAGSNLPAVPNVAA DAGVAAAPAVPAVPQAVAQTAPSVPQVANVAAPVVGTAEAQNVLPDVPQVAQVTAPAA VEVPAVPVVPAVPQV" /product="Phage protein p21" /transl_table=11 CDS complement(31301..31612) /db_xref="SEED:fig|Theralytix Phi11.peg.38" /translation="MKELHPLHTPEFVKTFLDQTGCLPGVRRTGRTTGIALQAIGMAL SHPRETLTFVDHPDGSAAALVASIETILATLGYKNVRVRPTTRADGRSVSIVFKTLPN A" /product="Phage protein p20" /transl_table=11 CDS complement(31609..34032) /db_xref="SEED:fig|Theralytix Phi11.peg.39" /translation="MTTIRILDLETESHEHKGRKASPFDPRNYIVMAGWRDDVDGKVG QKVEHRFRSRAEAEDPNNRWFNLDGVDVIVAHNAMFESNWFFTRYRDEYLAFLRRGGR VWCTQQAEYLLSHQTWLYPALDELAPKYGGTHKVDGIKMLWDQGVLTSEMDQDLLSEY LSGPCGDIENTALVFYGQLMKLQARGMWAGYLERCEALIGFSAMECAGLKVDLEVAKV NHAKQLEEVAGIEAELKKLMPDFPEYFEFKYTSLYHMSAWLYGGEVRYKGRVPYEDGR MEKADFVRFGTAKRGTPIESTSVRVPIHEVTDQGEWHWPTITELATKHGPVITFSAGK NKGSVKVFREDTDIPATKWDDDQRFRFPGLINLTNLPEVVREKFLGKRPEFQCALTLA DGSPVFSTSGDALKALEKQGFEAAKLLMRLAELHKDNSSFYITHTYNKDGTIKDTKGM LQYVDDDGIIHHSLNTTATATTRLSSSRPNLQQLPSKDEDDPEAGSRVKEMFVSRFGA DGMIGETDYTALEVVMLAALSKDRNLLAKLMAGTDMHLYRLAGKHNNWNGFDYDQLVA IKKDPNHPWHGRMMQARKNIKPKAFSAQYGASAAGIAFNTGCTVEEAQEFLDNEAALF PESIAFRQIVRDSAEATSLVMYKAEDQMPAGAFSEMGPDGNWRQYRRGFWQAPGGTCY SFRQQERWDKEQRKTVMDFKDTQIANYWNQGEAGFMMTVSVGRIFRWMLHRPGFMVTE FLINNVHDAVYTDCHKDTAAEVNKGVRDIMADAARYMSERLGYDIADVPFPAVAEMGP NMFNMEVIQ" /product="Phage DNA-directed DNA polymerase (EC 2.7.7.7)" /EC_number="2.7.7.7" /transl_table=11 CDS complement(34029..34364) /db_xref="SEED:fig|Theralytix Phi11.peg.40" /translation="MRMPTEEERMIRCLLADIHEPLNLLFPGIRVKAETMPLGWGDSI CALVLRVSYEHLTLGRLEYMHEVPILHLSQWGRDGMLQHLMNEIPRRVLDGMLRQAQK YSQSNWYSK" /product="Phage protein p18" /transl_table=11 CDS complement(34361..35308) /db_xref="SEED:fig|Theralytix Phi11.peg.41" /translation="MSKRDVVLDIEKGIWRGVDQNDKAVEAIIKKNGYVIVEPKIDGC RAIVGAHGVVSRSGRRFPALDGLEDRIIAKLSQSGLDSGLVLDCEMYLEGMPFSEATG RMARKTPLTKAELKCLHFAVFDATHIGVLRKSRKSHLVYDERRAMVRSLMEDCRRGDT PYFFQVAAQSCRSMEAVLRWYGYHRAMGFEGSMEKDPSLTYRNGKVAGCYKRKPEITV DGRIVGYVMGKTGKNVGRVVGYRVELEDGSGTVAATGLSEEHIQLLTCAYLNAHIDEA MPNYGRIVEVSAMERSANTLRHPSFSRFRDLASNPGVKV" /product="Phage-associated ATP-dependent DNA ligase (EC 6.5.1.1)" /EC_number="6.5.1.1" /transl_table=11 CDS complement(35308..35925) /db_xref="SEED:fig|Theralytix Phi11.peg.42" /translation="MQAKHSRVLEGTKEIPLGSIALPTGVKALLLRLYSDARPNEGVA LAGGFPRDLMHGATPKDVDIALYGMTQYQAEVLINSVLPTLDPRFVRDGGWSTEYANA GEGGIFKGVLSLVGCRGLEGMDVDFNYYDADSLGRVMESFDFTINQVGIAYNWPDPEG GPRLGAYLHKDVTWGVNKEVGAGSRLPERCEKMRAKAAYYGWENV" /product="Phage protein p16" /transl_table=11 CDS complement(35915..37105) /db_xref="SEED:fig|Theralytix Phi11.peg.43" /translation="MGPETCFVIDWIEQYWKVYPAHQKVDPQALRELIKLRGGYQPEQ LAVVLNLVNQLDKPVDPDSLQGVVSQLNELDFSGRVDALLAQYNQGEDIDLAYELRRL SDEALRREGVSTPTDYVTDDVFDILAEEQGDHGIKLPGLVLPAYMKGLHAGASVLVAA PPDAGKTSFMAWIAVHIAPQLKRYFDPGRPILWLNNEGKGRRIKPRLYSAALGMTVGE ILALDPEEVRKMYAEKIGGDSELIRIKDFHGGSLAQAEQVIDAMKPAVVFWDMMAHVK GGQRKDQNRTDEMEYKVAEVREMAVRHDFISFMTWQISNDGHDQLFPPQSCLKDSKTA VQGAVDVQIHLGRLNGADQQVMRGLSLPKNKFQMDGKPSNVEAMINFDAARCRFFESV DHAS" /product="Phage DNA helicase" /transl_table=11 CDS complement(37152..37976) /db_xref="SEED:fig|Theralytix Phi11.peg.44" /translation="MALRRDSWLKQAQSLAVGQVGRFRHVLGCQSMSRGGTNMTCKNL PDRWVAYCYSCQEGGVVEKTHVRRVQCADQERFMPWPEDASDWTQADCYQSLYGLLLS KGIDYNVMTPGLPLLYSERQHRLIFPTDAGWIGRATADQNPKWVGYGYPAPDYHGWPQ ELSMGRPWVLTEDYLSALKVRWACPEVFAVGLNGTRLRDRLAAIMLQQTCKRAFIFLD GDPAGVRGSAGVMRRLRSLLIEGQVIHTPDGFDPKDLTREQIRSLVIGRIDATRTE" /product="Phage primase/helicase protein Gp4A" /transl_table=11 CDS complement(37949..38047) /db_xref="SEED:fig|Theralytix Phi11.peg.45" /translation="MTWHLQDMFEARGGLRPLWEEWYQWHCAVTPG" /product="Phage protein p51" /transl_table=11 CDS complement(38044..38172) /db_xref="SEED:fig|Theralytix Phi11.peg.46" /translation="MTYEVMTWLIENKPLVIGVAFSLVALGVLLTQNNGGPPTAPA" /product="Phage protein" /transl_table=11 CDS complement(38162..38704) /db_xref="SEED:fig|Theralytix Phi11.peg.47" /translation="MSKTSLYPLNLHPGLIQIRTIHVFSIQAPSNAENWWQWFLWQRK YHPLRESLSPAGELSASIAECVLHLRRNGWQDSDIWRKKGGVLALGAFDLSGLMVGSC LVVGGELKALCVDDRHSRQGIGAELVRAAELAGAEYLTCFEFLEPFYADLGWSTTHRE ANWTAGEPDVLHMRAPGHDV" /product="Phage protein p13" /transl_table=11 BASE COUNT 6629 a 12133 c 12046 g 8158 t ORIGIN 1 gtttctccag ttgtcattga atccagcgga acgcccgctt agcaggcgtt cgacttgagt 61 caatgggcgg cagcgcgctt gctctgctca gcgatgggtg cagccttggc ggccagcgct 121 tccaggtcac ccagcagttc catgccgacg atcaccttgc ccttggtctg cgcctggagc 181 acctgctttt tgatcgtggc cagggcagcg gccaggttaa actcctggtc cagcgctttc 241 tcaggcttga agctgtacca cgggctgttg gtggcgccga cgagatcggt cttgccgaac 301 ttgttgtaca ggaagggcag gtccttgttc gatttcttgt cggtgttaac ctgtaccttg 361 ccgtgtagca ccagccactc gaccagcgca ttgcggcggc tgcccttagg catggcttca 421 tacagcgcct tgactacggt cacgtcaccg cactggtcga tgtggtggat gatcgacagg 481 ccggtcagtt gaatggcttc gtcgagttcc ttgccacgga cacggatggc gtcgatagcg 541 cggttgatct cttctgtgcc acggaatgcg attacggttt tggagattgc gttggtcatg 601 gtatgtacct cagatggatt tgttcaggta agcagcggcg gccaggtagc cggcactgcg 661 tggagtggtc agggtatcga cgcggggctg cttagcttgc gcctgttcag ccttgcggaa 721 gatcgggcag tcggcgcctt tcggcatctt gtgcgctaga tcaatccggc gtgccttgtc 781 gcggcgagcc ttggcggctt tgcgttgacg cggcgtcagt tcattcacac gtggcattac 841 aaacccttcc cttgcgactt cttagcgttc catcccttca ggatgttccg cgccttgcct 901 tcgctaccct tcacgaaagc cttctgttca gggttgtggt agcgtcctgg cgctggctcc 961 gggtcggtag cgtagcgcac gtcacgcatc ttgcgaagct ctttgcgccc ttcgacgtta 1021 tcctgtgcga tgagcttagt acgtttggct tcccagtccc gccagtacgc tacctgagca 1081 gcaaagggcg acttgggagc cttagccttg aagtgtgcca tcggcaatcc tcactaggtc 1141 tgtctcttga atcccctcgg tggaagggcc tcaagggaca aaccttggca ttggcatagt 1201 ccctgtagta tcagcggttc tggcttgtcc tgcgcatact cttcgggatc gtcagcactc 1261 ttcccccgta ccctttgcgc tatctgcctg gccttgttca atcggcccgc cgatactacc 1321 cagcatactg tcagtcgcga ttaaccgagg tttctagttc tcgatcccac tgacactctg 1381 ttcgttccca ccggcactaa cgtgcctttg cttaaccgtg gacggggagg cttcccgctc 1441 agactctttt gggtgagtct tcagcacccg acaggtattc cctgggaccc tgcctaacca 1501 gttgcagctt cagtcaacct accgcaccag tccatgtacc gctggtgaag cttcgaacct 1561 ctaccgccag atggctcagc catcctttcg tcttgctgcg catgttagag acttgcgctt 1621 gtcttgtcaa tcctctgtcg gggattagtt cgtccagttc tctggcatag gcccttttgc 1681 tgagtggcca tcagtggtgc gaactgtacc gcgtgccctg caccgtgtca gtcccctaag 1741 tgatgcctgc cggccttaca cactgcggtt cctgccctaa gagtttgccg tgtcccttgc 1801 gcctatggct tgtgccgcgc ttggaaggtt gcaatctccc gtcgttctgg ctgcgtactc 1861 taccgatgcc ctggtagtgt gtcaaccctg tctccaggct gcctgtggag gcggtattgc 1921 gtgaagacag ggcgaactct acagacctgc cgcccacgtg tcaataccct cgccagggcg 1981 ctccctggag ccttcccacg cgtatagaga cccacgcgtg cgaggcttag tctggctagt 2041 caggattatc gttcccaggt aacgcaaatc caccacccag ggagcagcca cccagccagg 2101 accaccaccc tgaaacccgc gtggcactaa ggctgcggtt atgtcacaca caatggacaa 2161 ataggcgtcc atcagcgccg caggtgcgac cgagcaggcg agggagtggc gaggcaagac 2221 agcaggacca gcggcagcac aagcacagcg ccagggaggt agaccagcac ccagggagcg 2281 acaggtagag ccaggaggcg atagggagca ggactagaca aggcagggag aggcgagtag 2341 agtacgtggc ctagagggag tggccagaca gagcacagga ccacccaggc agccccaggg 2401 aatacccagg gaagcgccag gtagagccac aagaggcaat accacaagag gcaaggctac 2461 gctgagaggc aaggctagcc actcccgcac caccacccga caggaccaca gaccaccaca 2521 ggaggcacag gaggcacaga ggatgctgag cagacaggac agaggcgagc gagcctggca 2581 ccagcgcgac gcagcatggc agaggaagct agccaggtgg gcgacagagg atgagcagca 2641 cagcccgtac ccagcagcca gggccagagc cagggaagac cgtaggctgg cgctggtagc 2701 ccaccgcagg gcgctgggta tgagccgatg ggcagccacg ccaccgcagg gttgacactc 2761 ccgccaggat gcgtagaatg ggcagcgagg gcagggaagc cctcgccacc cggcgaagcc 2821 ggaagctccc aggaggctag gcagtggccc accagacgag ggcctacggg ggaagggtgg 2881 gcgtgtcgga gtcgggaggg ttctcacacg acgatatcaa aattggaccc ggagtaacta 2941 ctcccgccca caccagccaa cccagcccac acacaccctc aataaaaatt ccagtagttc 3001 cagtggagca cccgactatg caggtgctcg gcttgaacta ctacgcgtag accttggcct 3061 tggcagtctc gacagcagcc atcagctcgt cgaggtgcgg gacgtactca gtgcgtagtt 3121 tggtcccgtt gtagccagaa cccagggccg cttcttccag cgggcggatc aggttctcga 3181 tagtaccggc gaaggcgcgg aggtctttct gagttgcagc ggcgaaggtt gccatggttc 3241 agttccttgt gctatggatg gagtcaggtt ggacgggctg tagctcagcc cgccggtgcg 3301 gtgtacacga ccttggtgat ggcgccgttg gctacggtca ccttcacgga accaccgccg 3361 tccacgggca gggtgtcacc gttcttcacc ttgtaggcgg tgagcgggtc cggtggggta 3421 gcgccgccct cgccgcccag ggcagtggct gctgcgatca cagcggtggc cttggccttg 3481 acatcggcct cgtccatgtc gtgtagggcg atgcggttgt cggtgccggg ctggcatacc 3541 tggtagaagg tcaggccggt gttacggcca gcgaggtact gctcgcgggt gttcgccatg 3601 tcaatctcct tgattcaggg cgttgcatag gtccagggcg tcctgatagg ccgctacagc 3661 gcggatcagg ccagcctggg tggtagggtc aatcagtggg tgttcgcaca gcacagcggg 3721 cgccggggcg gtcgcacagg ctgtcaacga cagcagcagg cacaggccgg tcagcccacg 3781 ggcggttctg gtccagggca cggtccacct cctggcgctg ggtgttggtc ctggcagcga 3841 cctccttgac gtggcgctgc aaggtggcat aacgcacctc cagggcctcc gcacgggccg 3901 tctgccgctt gatctcctcc tgggcgatac ccaaggcccg gtagctctgg acgaagccgt 3961 atgaggctcc cagggctacc acagcaagga cgagtattgc gacgatggtt cgaggcattg 4021 cttgatctcc gcgttgcggc gattcacgag gcccttggat acgaccttct ggccgttgat 4081 cgtgaccttg ttccacatgg ccagggcttg gcagccctca gtggcgcggc cttggttgaa 4141 gcgcttgaac gctgtgctgg ttgtacagac tggacccacg ttgtagcaga agaacgtcaa 4201 ggcggtctgc tcattgacgt tcagcggcac cttgatggcg tccaggacga tgcgctcgaa 4261 gcgctggaag tccttgatcg tcatctggta gcactgctcc ggtgtggctt tgtcgcccat 4321 cttgacccca gcggtagtgc cggagcagat ggtgggtacg ccggcgatgt ctcggtaggc 4381 ggtagtctca ctgccttcca gggcgacaag gccggcgagg gcagccgcca gggctgcgcc 4441 gcgcaggggc ttgttcactt cttgaatctc cggcgaagct ccgcgatgct atcgagcatc 4501 tttgggagca gggtgatgag ctgtgcgccc acatagagcg cggtgagtac cgcagcacag 4561 aggctggcga tctcgtaggg cgagtaaacg gcgatcccca cgccggtgac ggcgagggtg 4621 cctttgcccg cctcggtggc ggtatcgagc atcatagtct tcgtcctttt gggcggccct 4681 tgcgacgctc ccggcccatg ccgagagacc gaaggacaga cttagtgtaa cccatcgggt 4741 tgttcagcca ttccttcttg gcagcctctt cacgagcgcg ggtagcggct tcgtcgtcct 4801 tcacgagcgt gggtgctagc tcgcggacaa ggccctcaag ggcatcgatc cggtcgtcct 4861 tcggcagtga gcctcggtcg gtggtgatgt tgtgaatctg gtggaacacg gagcgctcgt 4921 tgcgcttgtc cgctgggtac tgctggcagg acacgtggtc ggaatccatc gccgatacgt 4981 ggaagatcag acggtggcgc tgcatgatgg gccgcagggt gtcgatgata cgacgctcct 5041 tctggccgga cttctgccgg tcttctacgc ctataccctc ataacggggc ttgccggtat 5101 ccgggtcgat ggatcgaatg tggttgcgga agagctgacc aactgcacca gcgccgaggt 5161 ttttctcgac atagatcacc ttgacgccgt aacgcgcagc cagggcaatg catttctcca 5221 ggttctcctc agcgaagcca cccttccagc cgccgatgct cacgacgtgg atgtacgggc 5281 caagagtccc gcccacagca tacgacagct cgtcgccacc gtcgccggca gggtccacga 5341 acatcgtcat ctgctggagt ggtgcccagc cgccagccat cagcgccggc aggtacagct 5401 caggtttgat gaccgggaat cggtgagcgt cgaacttgag cttgaagcgc tcgtcggcag 5461 cccaggccac ttgctcaggt acactctcgt gcgtggcgtc gatgaacagc aggtcgcgca 5521 gcttgagctg catacgctgc tcgtcggcga ggctggtgtc cagcatgtac tgaagctgga 5581 agccctcggg gccttggtca agctccttgt cgagcaggtc ctcttcgttg tagcgctgcg 5641 gatcggcagc ccagccacga gtgccatcca ggcccttgcc agtacgcggg ttgtggcctc 5701 tctcctccag gcgggcaatg cgcgctagga tggaaggtgc gagccagtca ccgtagcgtt 5761 cctgctcatc cagggtcggg aagcggcccg gccagatgcg catcaggaag ccccgcgccg 5821 gcagaccgtt gtagatcgac tcacgggact gcggcgtgcc caggtagaga atcttaccgt 5881 gggtacagat agaggtgaac tcctgcgact gccgcgtcag cttggcccgc tcggtggcgg 5941 tgaggccgtt cttcgtggtt tcgatgtcgt cgggaatcag gatgtcggcc cggtagccct 6001 ggagggcagc ggtgatcccg atgcagttga tagaggccga tttctcgacg cccttcaacg 6061 cccagttcac gtcgaagctg gtggccgagg tacggtcacc catgcgggcc tcggggcgta 6121 ggtatgccag caggtcccag tgcatgatca gcttcgtgat caactggccg ttctcctcgg 6181 ccttgtcacc ggagccggat accagcatgg cgcgggtagc cgggttctga gtgatgcacc 6241 agaccacgta gatacaggcg atggtggact tggcctcgcc acgctgtgca gcgaccatcg 6301 ccttgttggg cgagtcctgc atgaagtcgg caatgtcgag ctgcatccac gtcatcttga 6361 agccgaggaa cagcatggcg tccaggcaga agtcccggaa gcgcggatac atgtcccgca 6421 cctcgtgggc tatctggaat cgttcttgcg gcgtcatgct gcctcctagt gggtgtacag 6481 gcgttccatc tcgtcgtcgg tctcaccggc gatgaagccc tccaaggcaa tgcggcgatt 6541 ctctgcctgc gcctgccgca tctcctcacg gagacggtcg atgttgatgg tgtcggacgg 6601 atcacaggtg atctcgttgt ccttgaggaa cttagtggcg gcagcgatat ccgatgcggg 6661 gatcgggatg tcgttgtcca tgtaccactt gaagttgcgc tcgatggcgg tgcagaccag 6721 ctcgtgaagc aggcccagcc gctcagcact cgcggtctgc tttttactca ttacatgtgc 6781 cctctgaatt ggacttggaa gcggaggttg gtgcccatgc cgcatttcac cagaggccgg 6841 aataccttgc cggtatccac ctccaggtgc tcttcggtgt agttctcatt ctgcgtgcgg 6901 acgtagaggt tcccgttgcg ggtgtagggc acgataacct gcgcccaggc ggtagccccc 6961 ggacgtttgt cgtccagggc caccttggca tagtctacct ggcccagctc cacgaggagc 7021 cgccggccct gctgcacgtt gaagtacgag atcgcgccgg tgcggtccgc tcgaacgaaa 7081 gcacacacat agttcatgtt gctgtcgaag tcgagggaca tcgtagagat gccatcctca 7141 ataccaccgc cgatgcgaat ctcgttcgag ccatcctcat atcccaggta ggtcccgtcc 7201 tggcgcagct ctgtgcgcca cacgcggacc aacatcccct gggacgggtc ctggatagct 7261 acgcccccgt cgcagaagtc cagcacgtcg ctgatgtccc tacgaccacg agcacctacg 7321 aacttggatt tagccttcgg atcgaggtcc aggttgaagt cgtagatcag tgccatgagt 7381 tatgccctcg ctaccgagaa ctccattgtg atggagaact cctgcgtgtt gttcttgacc 7441 acgggagggt cgattgtgag tgcgtagttc cggccattgt aaatcttcag gtccttacag 7501 ccggtgatgc caccaggcat gttgccgtta tccacggtgg cccgcagcat gagctgtccc 7561 ttgtaggagc cacgcacata acgcgggtac aacttagtcc attggccgtc ttggacatcg 7621 gagccagacg cactcttacc gtggatacgc ggactctcgt tgtagaagat ataacgctca 7681 ccgtagaggt tccgtcggtt cgcgaagggc agcggagtga gtcggatggt acgctcgacc 7741 ccggcgatca caaacttggc ctccgccatc gtcaccgcct tactgcgcag ctcatactgt 7801 acgtcaagaa tctcgtcggc ctggactacc aaagtggttg gctggccagc ggaatctttg 7861 atccgggtgt aggagagggg agtacccgcc ggaatcttcg cgccggtgtt actctcaaac 7921 cccacctcgg atcgagctac gatgcccacg gtggccagta cctgaccggc cagggtgcct 7981 attgggaagc gccaccgctt gtgccagtaa atccactccc cgtccaggcc cgaggtcacg 8041 tcgccgttag gggcatacga ggtggtgcgc cgaacttctt ccggcaggga gggcgcggcg 8101 gggttagggt ccgctgtgct ggtgctcacg gccagtgcct gggagaacag gtctgaggtg 8161 tccatggcgc aaatccaatc gagacctgcg ttagtgatga ggttgtcgaa ggtgtactgc 8221 gccaggacct cgcccgtggc tttcagatgg gtcacggtgt agcgaccctt aacgcgtgtc 8281 ttaaacattg gtcagttccg cctgtttaat tgctgtagtg gtggcgaagg cataaggctc 8341 gacgatgtat tcggaatata caacgacgac cttcagctca gcacctacca ctgcggtctg 8401 tgacaggaac gcgtatggtt ccgcgttgta gcccttaacc gtgtcgcgca gcagtgctgc 8461 gtggatggca ggtccagtca agaacccatc gccgccgcca tacccaagct gagtcagcga 8521 cctcagcagc acttcgacca cgccggcaga cgcctggtag gtgtcctcac caggttggtt 8581 cacaacctcg tgcagggtgt cccgtgtcag agccgccact atgttagcct ggcaggacca 8641 tgtgtcgtcc gtggctagga tggggtacgg ataggtggcc aggatgggct tgggccgtcg 8701 gatttgagag gccatgatgc ccgcgataat gccgcgcatt attcgtcctc catcgctccg 8761 aacacgaccc aatggttagg cccgagacgc ttgagcgtac acacgccgtt ctcgccgtag 8821 agctgcatgg tggtgttctg taggcggttg atcgtcacgc cagggccggc cacgatgttc 8881 aggtcccgca caccggcctg ctcgaagtga acctcggaga actcgatcca gggatcgtcc 8941 gggtcttcca tttgcatggt gacggtgatg ggcttgtccg ctgtcatgca acggttccag 9001 tacccacgcc actccttgct gatgtcggtg tcttcggtga tggtgcgaat ctcggcgaag 9061 cccagggcac ggcgcagcgc ctcattggcg gcgtcgagtg cgtcctgtgc caggcgacga 9121 gcttcctcgg cgatgcggat cgcgtcgagt acgccgtcga gagcgaggtt cgcggtgttg 9181 atgccttcct gcacagcgta caggagctgc ttgttgttcg cgtcgatgta tcgaggcagg 9241 aacgggatgc cctggctgaa ctgcgtgtcc gggacctggg caggcgtgtc gcggaagatg 9301 cggacctctt ggtccttctt cggcaccacg gccaattgga tgttggtgtt gtccacccac 9361 gtgtagtcgg tggtgagtat cttatcgacc tggacgaata cgtcctcacg ccgcaggaat 9421 gggaagtcga gactgaagac agcctcgacc ccatctgcaa cgtggatggt ctcgggattc 9481 ttgaaccgag ccacgttatt cccctttgat ggattccaac agcaacttgg ttgccgggaa 9541 cacgttgacg aaaggcagtg cccctgcggc gccgctgacg atatcgccgg tggcggctgc 9601 ggggtcgtcg ccggttacta ggtccttgac gccacggaac acctcgttgg agtgctccgc 9661 cagcccgaag accggggcgg acatccggga gtgcccggtg actacgcccc acatgtcggc 9721 ggtgaagccg aggccggcag tgtagccgat gccgtcgatg gccatcttgc ggatgccttc 9781 gtcagaggtg tcgaacttgc cgttgatcgc tgccttggca cccatcatca gcgcggtgag 9841 cggatactgg aatgcgagga gcgaggccac gccaagcacg ccggagttct cgtaggttcc 9901 ccggaggagt ttgttgtgcg cgaaggccac aaagctacgg aactggccca ggatttgacc 9961 gacaggtgac cgggcaaagc ccgagttctg accgactcga ccgtacagca gtgagtcgtc 10021 catgatccgc agtgcggtat tcatgacggt gttaacgtct gcttggctcc aggcgcccca 10081 attcatggat tgggcgttcc ttcctctgta tgtgacataa ccgcgaaccc gcgccaggac 10141 tggcgtccag tccacgtcct tcccgtactg ctggagcacg cgaagggctg cttcatcccc 10201 ctgcgccgcc cgcgccacct tgttcaaggt gaggttggcg ttcatacggg attgccagtt 10261 atggatgaac ttcatgccgt tgagcacggg gacagcctgc ttacccgcgt ggaggaagcg 10321 atccatgaag gtgtcttggc tggccaggaa ggtgtcgaac tgccgcttcc agggcttcat 10381 ccgaatatcg ttagcgaggt tcaggccgag aacggtctgc atctcatcag cgaggtccgg 10441 gttgcggcgc atggccccaa cgaagtcacc catgcgggag ttcagcatgg ccttcataac 10501 gttgaagacg ccctgccggt gggccatcgt ggccagctca gcaagctgat acacgccgga 10561 gaatcccagc atggtggcgc tggtcaggcc gctggcccgc tgtgcaacgg ggccgagctg 10621 gtgctcacgc ggcacgttgc cggtgaagtc cccgaagacg ccccgcagtt gccccgtcag 10681 ctcctgcacc ttatcggtgc ccaggtgggc tgcctctcgc tggtactccc ggatgaaggc 10741 ttcgatctcc gagtcccccg gcatacctgc gcgggccaat gctgagcggc ccgacatact 10801 gccggcgtag ttctccatca gccggtcgag gtcccggtcg atcaggtcct gcacccgata 10861 cacggtgccg ttgtggttga tctcggcggt catgtccagc gacagtcggc ccttgccgta 10921 cttgacggtg ccctggtcgg actgcttctg ctcgatcttg gccatgatgc tgtcgaactt 10981 ggcctgggac acgttggcct cctccagcgc ctgccggatg aatgccgtgt ccgctacacc 11041 catcgcgccc atgaactcgg agcggatgcc ggtagccctg tcccgcgccc gctgcacaat 11101 ggcctgtgcg atggtatcgg cgtcagcccg gtccaggcca gggatgccac ggaacactgc 11161 ctcgctgatg gctcggcggg ccagcccagg ggcggcctca tccatctgag ccatcttgga 11221 ccagttccac gagcggtgga agtaccccgg tcgcggtgcg aagtcctcga aaccacgcac 11281 acctgcttcc ctggcccgtc ggcccatcag accatgaatc tcgtctgagc ggtcggccag 11341 ggccttgatg gtcggcggca ggttcgggtc tacgcggacg ctaccgtagg cagtccactc 11401 ccggtcccgg cgcagcagct cccgcgtgac ctgctcgttg agctggtcgc ggacagccat 11461 agctcgtcgg gagttcagcg cacgtgccgt caggccaacg ccctgctcag ccatcgcctt 11521 ggccatcatc tcgtcgtagg acttcacgta gccctcgaac tcgttccggt aacggcgcaa 11581 atagctcgct gcgttgtcgt tcgtgctgaa cccatcccga cgtactgggt cgtcgataag 11641 acggcccagg aggcgccgtg cgccctctcc gggctgggcc aggaggtcgg cctcactgaa 11701 gaaccggttc acgaagccag caccttcacg ggcgcgctcc cgagtggact gcacgatggt 11761 ctccaggcta gcctcctcgg tcaccggagc gcccttgttg gcccacttgg cctgagcctt 11821 ggtgtaaccc ggcatggcgt ccatgatcgt ctcggacgcc gccaggacgc ggctcagggc 11881 cgtgtcagca tcggaccgga ggcccagcag gctgcggata ccctccacga agcgggacca 11941 cagtcccggc ccaccgtcgc tgtagcgcag gcggttcagg gtcctctgga atcgggtatc 12001 cgtcaggccc caggctacca gctccttgac gttggccaag gtgttggagt tgccggccag 12061 cagcgtctcc tcgaactcgg acagttgccg accggcggcg cggtcttgct tcagggcgtt 12121 gagcacgtta ccccggacgt tctccagggt ctgcatggcc tgggccacct tgggactcat 12181 cgccccaggg ttccgcaggg cagcgttcat cacgccgacg gtagcagcgt ggaccgcttc 12241 gtggagcacg gtcaccgggt tggtgcctac acgtcctgga gcggtgctgc cgcgaacctg 12301 gaccagggta tcgaggccct gagtggagtg gagtcccgct gtgcctggct tgaggaaggc 12361 agagctggca gtgtcgccgc cctgcaccac acggaacgcg gtacgctgcc ccaggccctc 12421 cagggtcttg agggtgtcag ccaccttggc ggcgatgccc tggagcggct taggcacctc 12481 ggcgtgggtc ttgaggtgat ccacaacctc ggacagctta cggcctgaca ggctgtgcag 12541 ctcgtcgccg aaggccgtgt cacgtcgcgg gatggccggt atctcggcct gctccacgcg 12601 ggcgctaata cgggacagca cggtgccctc gtccagcagg tctaccacgt caccggcctt 12661 gaagccgcgt gcggcggcct cctcggcggt catggctact tctggcagcc ctacagtagg 12721 cgccgatact tcgggcacat gcggttgcgt cggggcctct gcggcaatgc gtcccgcacc 12781 agaccccagc agagcaccca cgccagcgcc aagagcaccc gccacgatgt aggttccggc 12841 atccacgtcg gcccctgcgg catccagccc agcaacatac ccgacttgcc cagcgccgcc 12901 agcagcagcc atgccagcac gaccgagccg cagagcacgg ccagcgccga aagtaaccgc 12961 atcaactgcc agggctgccg ggtccagcat accagccgcg aagttccagt acgggttgtc 13021 ccgcacgatt tgttcgtcct gctcataccg ttgaatcctc gataggaggt aggccgcgtc 13081 cttggcattg ccggcacggg ccatgatctg aaggtagtta tcagtcggct ggatacctgc 13141 cgcctggagc gcctggaccc cataggtccc agcgtcgaag ttagggtcca cctcgccggt 13201 actgttcgcc gcaaggtctg cgtcgagctg gagcgcatcg ccccagcgtc cgacgagggt 13261 ggactggttc cagagtgcgg aagcacggtc aagggccggc agttcctggt ccgctacgat 13321 gcgttccagt tcccgcgcat tggctcgttg gcccgctgcc acgttccgtt ctccgatctc 13381 gccacccgtc agggcgtcga accccacggt aggcaccgcg tcgagttggc cctgtacttg 13441 ggcctcgtcg agctgtgctt ggtcaagggg atacttgggc gtcatgcggc ccttgaattg 13501 ctttgccatg tcttactccg ctgttgcggc gctgtaccaa tcgacaccga tttgactcgg 13561 tgtatcgaag tggggcgcca tgcgcttgat gaatgcctcg gcccggttgg gcgtctgcgt 13621 gtaccacttg ctgtttcgca caccagcctc gaaggcttcc ttgttgcgat ccttgatcgc 13681 ctggaaggtg ttacggaact gtcgggcacg tccttcgccc atctggaagg ccataccggc 13741 caatcccagg atagaggcat tgttcgtaac gcccagctcg tcggccaacc tcacaccctg 13801 gtcgagtgcg cggtcggtgt cctcggcgaa ccactgcgcg gcttgctcag gcgtgactgt 13861 agtgcctgcc ccagcattgc cactgcccag gtaatgcccc aggcccacac tataaccatc 13921 ggcatcctta tacgcctccc ctcggtaagc ctcgaactga gccagttcct tccgccagtt 13981 gaacacgtcc tgcttcagca tgccggcact gttacccccg ttcatgcgaa tgtccgtgcc 14041 gctgaccttg acgttggcac cgtactcggc gccccgcatc gcattcagct tatccgcgtt 14101 gcgcttgagc acctctttac cgactgcctg gggatcaacc cgcgtgcggt ccagggccac 14161 accgttctcg tcgtactcga cggcgaggag gctgccgctg gtgcggtcgt actcgaaggc 14221 gactaccgac ttgtagccga ggagtccttc gacatgcggc ttgtgctgct cggccaggac 14281 ggttccgatg gtctcggtgt cgttggtccc gaatagctgt tcggcggtag tgccacgcgg 14341 taggatcagt ggcgcgctgt cgcggcggct gaacaggtcc ccttccttca ggttgcggcc 14401 ctcgcccacc tggatggtgc ggttgcgcac gttggcggcg gcgatctcca gaagggcttc 14461 gcggcccgtg tcgctggtga gcagacccgc atgcttgcgg tcgctggcca gccagttcgc 14521 ctcgtcgatg gtcgcccggc gatacatgct caggacggcc tcgttgttgc tcaggtcgct 14581 ctcgccggtc agcatgttcc aggcccgacc gaagatgttg ttcacgaact tgtcgttgac 14641 ctgcttaccg aggttgtcct tgaatgcctt ggtgttctgg cctttctcga actcgtccat 14701 ctgcttcacg acttcggcgt tggcgctaaa ctcgcgcaga gcttgagctg gggcgatgcc 14761 catcttcatc tgcttgagtg cccaggccac ggcgccctgc tcggcttccg ggatgccgga 14821 tagcatcacg ttgccggcgg aggggttgat ctcctgggcc gaggccacct gttcgaagat 14881 gctgttcagc gtgttgacca gctccggatt tgcctcgcct tccttggcgg cctggatcat 14941 gcgcaccgcg ctgcccacgg actcgccgta ggtcttgggg aaggtcccca ggcgcaggcc 15001 gagctgtgtg ccctgcacga gacggtcagt caggcttgag ccgttggcgg cctgcatctt 15061 gtcccactgc tccagcgcct cggtgacgtt ggtacccagc gtgtggaggg cgttgatgtc 15121 tccggcttcc aaggccgcca tgatgccctg catgcgctga gcgttgccca ggccggtcat 15181 ggccttggtc atgaatgaga tggcctgagc gtcgctccag cggccctcct cgaccatgcc 15241 tcgtgagtac gcctcaacct cggcaaggtc tgtgatggcg ccgttggcca cccgctgctg 15301 gaagtccgcg tcggcccgca gggtagccat cgattccttg gcacgggtct gtgccttcga 15361 tttttcatag aggccgttga gcgcacgccg gtcgtcaaag gacatactgt ccaggaaccc 15421 ggcatcgcgc aggccctcat agatgccccg ctggttcatg tccaggctgg ccgccaggaa 15481 ctgcatgcct accttgtcgc gcacctccag cgggatatcc tcggaggtca tgatgttggt 15541 atagaacagg ccggcctctt ccaggctgag ctgccgggac agttcgtcgc cggtggcctg 15601 agcctgcaca gccttggcca ggatactgtt accctgggta cggaagccac gggcggcctg 15661 gtcgatggac cagtccatgt acgccttagc ctgcatgccg aagagctgtt cctcggcctt 15721 ctgctgctgc gccagcgcct gtagggcatc gttggggttc atgccctcgg tcgagtccag 15781 gacgtgcgta gcctcctggg acaggtactt gcggaactcc tcgggagtca tctcccggcc 15841 cttgttggcg atgaatcgct gcatcttcag gctgaagtcc gcctgggcga tacggtagtc 15901 ctgcttacgc caaccaccct tcacgaatgg tttggccagt acgttgctgt ctactgcctc 15961 ctcagcctcg ccggccatac gggcacgctc accgcgcaga acttcctgct gcacgttgtg 16021 ctcgaaccat ttgccagcga tctgctgacc ggcacccagg atgccgtcga gaatctgcga 16081 gcctacgctc ggaccgctgt agttgacctc ggagtcgcgc actccgcgcc gagcactctg 16141 gcccggctgg agttgcgtct gtccgacgtt gatcccaagc tcttgggaag cacgttgcga 16201 ttccgccatc agttgcctcc tttaggcgtg gcgccgaact tgaagtattg acttgcgtac 16261 agggaacccg ccgacatcag accggccacc agcggggacc gttgccccgc cgtggtactc 16321 ttctgaccca gcaggccggc cttagcctga gcctggatgg agtgcgcctg ctcggcgagg 16381 ttccacatct gattgtccag gttgtcgtca atctggatca gggcctcgcc gacctcccgc 16441 tcgatatcca gggccaccgc atcgacggat gcacccttga cgccgaacgc cccggcctga 16501 gcctcggcgc ttccgccggc tagcatcccc tggcgcttgg cctccacctg cgaggccacg 16561 gcttgcttgc ggtagctagc ggccatgact ccgaggttgg cgatatcgcg ggcagcggcg 16621 cccaggttgt cgaggtccgt cttcagtcga gccttgttct cggccttgat cttgttgcgc 16681 tcttccttgt tggccaatcc ctgttgaagg gcggacatgc cgccagcggc caatagtggt 16741 agccagaaag ccatcacacc ctcctgtagg tttggttgga cttgaagttg tactcgacag 16801 cccgaacgtt catgtcgtac ggactgtgac agctcagctc gaacttggac gtggccatag 16861 cgacccgtgc cggcagcggc accacagcgc tatccaccag aggctccccg gcattgagtt 16921 gccggctgaa caaccgaagg ggcgtcgtgt cgtaccacgg ctggttgggt cgagccgtgt 16981 cgctgatgcg ccacaggaac tcgccggtcc agccgaagtt tacgttgtac cgatgaagca 17041 ctgcacgggt cgaggtcatg ggcaggccat tgtggtcccg gagaaccggt ggagtgaact 17101 ccaccttcga ccagaactca cagccgacca catacaccgc cccgaccacg gcctcgggca 17161 cgtcgaggaa caccttcgta ttcgtctcgc gcttcacacc gagatgggta cgctccatgt 17221 aggcgccggc cacgggctgt agctgataca cggcagaggc atccttgatc aggtcccaat 17281 gctgcttggt cagttccagc tcaccatcga cggtcgcctc gatacgccgc cagtagtcgt 17341 atttagggta ttgcagaccc tcacgggctg gcaggctgtt caggtgcatc cgtcccaggg 17401 cgatctcctg gcccttctga atcagaacca tcaggttgtc gccagtgaag taggcgccaa 17461 tgatctggtg ccgcaacgtc cagcgatgaa acgcgttctg cactttctcg ttgccctgcc 17521 agaggtactg gtggcagatc atctcgtccg ccgtgctggt gccgaacacc aggtagccgc 17581 tggaggccgc cgcctggatg tactcagcag gccccggcat gtagctcggg atgtggctgg 17641 taacgtcttc ggcgacgtag tggctgtccg tggacggaga cggggccatc tcatgcaggc 17701 ccatgaaacc cagggcacgc tccgcagcga agtacacact gcggccagtc acggcaggtg 17761 ccgccctggt atcgaggtcg tactgcgtgg tgatgctgat aaccgccgtg cggggagtta 17821 caatgccgcc accggggacc acggcctgat acttcttggc gaagacgatc aagtccttgt 17881 tgaaggtgac cgcgtgctcg tacggttcag tcaggctccc ctgggctgcg atctcgatag 17941 gatcatcgtc gttcagcgcg gctgccgact tcttgaacca gcggtgcgga ttgttactgg 18001 ccgacatgca gacgtactcc tgcgacagga ggacgaggcg accctggaag gtcgtcatgc 18061 cggtgatgcc tcgggtgacg aagttgaacg tggggttcgt atcctcgtcg ccggagccac 18121 gtcgatcata ctccagctcg ttcaagctgt aggtgtcggt agcctcatcc cagcgcaggg 18181 ccagtggcat cttcttcagg acccaatcgg tgccgtaggc ggcccgctct gcccagcggc 18241 ggttagcgga atcccactcg aagtataccg gggccttggt ggagccggtg gccatgacag 18301 cgccgtccat gaactgcacc cccacaccag gggcaccgac tcccggcagc aaggccggca 18361 ggtccgccgt agcattgagg ctcataccac ctgacgcgat gccgtagttg ttgcccatat 18421 ccgtggacac ttcaacgtgg atatcggcgt cgccacggaa tgcgatgtac ccgtcctgca 18481 cgccccgttg gttgaggtag ccggctatgg ttgccgcgtt ggcgtccggg tccaccttcg 18541 ggtacttctt cgtcgagttg ggcagagtgt actccggcgc accgaagaac ttgccgtaga 18601 gctgccacgc aatgtagcct acgctcgttt ggaatggcgc ctagcgaggt tggggttcgt 18661 gctggcgttg tccggcgtca cgtaggtggc cgtgtggctg taggtggtgc cggtggcgtt 18721 atccttgacc ttgatggtca tagagaatgc cttcgaatac tgacccgcct tgatgtacaa 18781 ccagccggcc ttgttggggt ctacgccctt gatgtcggtg cggtcggcct cgggctttac 18841 actcaggttg gcgatgaaca ggtcatcggc caccgtggcg gcccgtagct gcctgtaatc 18901 gttggccttg aggtagtcat gcaccagggg ctgacccatc agcaggcgac cgtcccgctc 18961 gtcgaacagg tacagctcgc cacggtgctg cgccaccagc atcgcaatgc tgcggccacc 19021 gaggttcgtg tggtagagga acggcctagg ccagggctgg tcggtatgca gcaggtgggc 19081 catcagctcg ataccgctgc gccgccgaag tcctgacacg ggatcggata ccatgttgat 19141 ctgctcgctg agctggcccg gcaggcgctc gaagggcacc tgctggctca cacccatcag 19201 cagattggga tacgcggatt gcttgtagct catactcagg tcctcaagct gcgccgccac 19261 cggctgaagc tacgcttggc ctgggtgttc agcggacggg atcgggtgtg catgcgggac 19321 agttcgttct gatacgcctg caattcctgg gcgatgacct gggcggtctc gtccggtcca 19381 atctcgtgag tgtataccgc gagcgcagcc tggtgcgcaa tgacgcgctg tgcgatctcc 19441 gggatatggt cccactcccg agacagtacc aatcggccct cgaccggctt accgatgcgg 19501 tcgtcaccgg tgttggcatc tcgcaccccc aggccgtccc actggaggtc cggggaatcc 19561 ggatagaatg ccaaggtgcc cttgggcagg ttgatgcggc ccgtggggtc aggtgtcagc 19621 ttgtgcctcc accaggtgtt gaaccaccag ccttgtgtca gcaactggat gcgttgatct 19681 tccagctccg ggagggcgat ggccatggtt ggatacgtct catccatgct cagggtcggc 19741 agctcgccga tcttgcgcag gatgacattc actgcgtcga gtagtagcat agggtttctc 19801 ctaaagcgca aaaacccacg cagggaatct gcgcgggtca ttaggctttg aagaaacccc 19861 acaccgaagt gcggggtttc gtggcatcac gcggtgatgt cgaaggcgcc gatacccttc 19921 agttcgatgg caccagcggt atccgggcga cgggcaccga tgttgtacat ctggaaggta 19981 tccaggaccc acgagaattt ctcgttgtct tcccacagct tggcctggac cggcgccact 20041 tgggcggtga tcagggtctt gctcgggagg aacagggcga tctggcgctc ggactcctcg 20101 gcactcacgt tgaagtgacg gcccagcggg tgggctgcga ttgccttggt ggcgaagcgc 20161 ggagtctcca gcaccttgac gccgttgagg atggccacgc gggacttcac gtagtcgttg 20221 gtcgcaccgg ttgcctggta ctcgacgttc atcagcttgt cgtgctccag cagcaggctg 20281 aacacacgag gcgacatcgg ggtcaggccc tcggagtaga ccgcatcgcc caggtcgcgg 20341 tcgatgaagg tctcgacgac gcggcggtgc atgcggacga tcttgtcggc agcttgcttg 20401 gcggtcaggc cggtcaggtc cagtttctcc agcacgcccg gcgagaacgc gtcttccagg 20461 tctaccggag cgtccatcgc ggcagccttg atcacctgga tcaggcaggc ttggtcgaac 20521 ttacgggcca gttcctggcc gtccagctcg gcgacttcct tgcgcatgtc gaaggattgg 20581 gtccactcgt cctggtggtc gaactggtgg cggaggtaca gcagggtgtc gacggtcagg 20641 ttccacttgt cgttcacgac tcggctgcgc tccagctctt caccggcacg acggcccttg 20701 gcctcgacgt tgcccaggcg atccaggcgg accacgttcg agccacgcag gtcgcggatg 20761 ttcatcagcg gtgcgaactt ggaggtgtag gcgaagtgct tatcgacgat gcccaggtgc 20821 tcttccaggt ggatgtcaac gtccgcgttc ttgccagcgt agttcggacg ggtcaggtcg 20881 ttcagaaagc tcatgcgatt ctctctcttt tggatgtgag tttaaggccg gagtagggca 20941 gggtcgttag ataccctgcg ccatacctgc cttacgacgc tcgcgcagcg cagccatatc 21001 ggcttcggat gcgttcaacg gcagcttgga tacctccgct cggtattgct cagcggacag 21061 agctgccagg gcaggtgccg cagcacccag gggttggccg gctgcctgta caacggcacc 21121 ggagccttgt gcgaaagcaa tgatttgctt cgctgcgtat tgcatggcct gggcatcgcc 21181 cgagtccatc agccgaccga tggcggcctt ggtggcaggg tccgcgtgtt ggttgaagac 21241 gccggcagcc tgcttcagga cggcctcacc accgacggcg gcataggtct gattcaggac 21301 agccttggtc tgcgcatcga cataggtcag gacgcccttg gccacgttga tgacgtgctg 21361 agcctgggcc ggacccagga cttccttcag ataatgctcg tcgatgaacc gaggatcgcg 21421 gttctcggcg gctttgccga aggctcggac ggtatccagt ttgtcagaga acgcctccag 21481 atagctgatg gagggtgcca actgcgggtc gccttcgagg tttcctgcca gggtgcctac 21541 gatctccccg ttgggagtga aggccggcgg cggcgggact tccaggttct cgggaagaac 21601 tgcacccgca gccggcggag ctaccggggc cggctgagcg ggtgcttgcg gaacaacggg 21661 ttgacctgcg gcaggcaccg ccaccggctg gtagtgcggc gtcatggcgc tggtcggaac 21721 aggttgcggc tgctgggtcg ggatggccag ttgctgcggc gcacccacct gaccgggctg 21781 gaccggagcc tgctgctgga tcaccgggtt cggcatcacc tgcacatggt tcggggtcgg 21841 cgcggcagcc gggggtatgt tggcaaccag gttagcgagg cccggcggca gttgctgttc 21901 gttcggttgg gtcatctatc agactcctgc gagtgcattg gtcatgtcgg aagcgccttc 21961 cagcaaggtc tcctgcgcgg cctgggcctg cgcggcctgc tgacgctgct gctccgcctc 22021 tgcctgtagc tcgtcggcgc tcttgtagaa ctgcgacgta tcgacactga aggctgccca 22081 aatcgtgtcc atcatcttcg gtagcgagat gcggggatcg agctgagcaa tcggggccaa 22141 gccagcaatg acttgggaag cgttgagcat gctctgcaca gcggcggagc gggacagggc 22201 gggaaggccc gtctcgatag ccggcttgtg ctgcttggtg atcaagccct ggagtagcgc 22261 atcatccacc tcggagaggc agacgtaggc cagcggcgac tggaggttct cggccaagag 22321 cgagtatgtg ccgcccagcg tgttctctgc ctcttccgca gtgatgcgga cttcctcggc 22381 agtgacgcgc tcggcgtctc gctggttggc accatacatg aacgcctggt tcagacgtac 22441 gactacggct tgcaagctct gctggatagc agccatcttg ttgtagtcgc cacgctcgta 22501 agcacggacg gcttccgcgc cacctggcac gtaatcgccc atctcggcgt cctggtagtc 22561 atcgactacc gcacccttgg cctcgtccac gaggttcagg acctccagcg actccagctc 22621 gtacaggccg agtttctcgc tcagcaggga cagcttggcg aagtcgccga tgtagtcctc 22681 gacgtggccg cgaccgtagt gctcgccagg ggcgaggttc caggtcggca cgatgtacgg 22741 acacaggtgg ataggccagc ggccctcctt gcccacacgc acgccgtcga tctcgtggta 22801 cagctcggcg tactccatcg ccgtgccctt cttgcgctgt acgtgggtgt acaggtccac 22861 gctgcccgaa ccggacaggt tgcggcctgc gcgcatcagg tcctgcttgt actcttcatc 22921 caggtccttg gacttgtagc gctgctttag gacgatatcc atccagcggc cagtcgcatc 22981 tcggcgcacc gcgtaggagc ggagcgacca tgcgaccacc gtagcggcgt cgctgtcgcg 23041 gtacagcaga gcattaccag tcacgatcag tagcttgatc acctgcgtca ggaccgccag 23101 ggaggcgttc tggaacaggc gctgtgttgc tttgcgatcc acccgagcca aggcagcagt 23161 cacttcggta atgtctgtgt cccggctgtc ggcctcgcgg cggatcgcat cagtgagttc 23221 ggatcggaag aacggaatgc ccgtggggaa cagcgaccgc gccagcttgg cagcgaggtt 23281 gttcactagc agggcgccgg cagactggaa gtcgtgttct acgacacccc ggctaccgga 23341 catgggatcg accatcaggt acgggagcgt ggtcttagcg aactcgatag cccgctgctc 23401 cacgctgccg tcccgcagct tctcccacag cattgctgcg gtggttttca tggcgtacct 23461 cgtcagtagt tgataccgag ggtttgcgat acgcctgtgc ccgcctgatt ccggcgtcgt 23521 cgagtgccgg tgccagtggc atcggccatc gctcctaggt caacctgcgc cacgttctcg 23581 gcggtgaggt caacctgctg gtttcgtgcg agctgatccg cctgctgttg catcagtcgg 23641 ttttgctctt ccatacggcg cgcatcgtct tgcgcaccgc tcaggtcagt gcccagcaga 23701 ccatcagcga gtttgccgat gatggtcttg cccagcacct tctttacttt cttgcccata 23761 aggcttggct ctccggtagt ggatcgtgta ccggctatcg ctttcacgat ggctccagca 23821 cacgaggggg atttgacccc agccggcctg acggtggagt tcgcggatga actcccgagc 23881 cacgcccgtg ttgcggtaac gcggcaagac gtactgccac tgtgcggtca cgcacgggcc 23941 gacgtgggga tcgtcctcga acacgatgca ggcgccgccg gccaactggc catcgcggaa 24001 taccagcaac tctgtccgat cattgccctc gatactgtca agcatcgctt ccagggcttc 24061 ttccttcgag cggaagaggg tgaactcttc cagctcctgt actgccagcc agcacaggcc 24121 catcagttcg gatggggcgc cggcctttgc gtggactcgc cagatggatt tggtcattag 24181 cgcaactcca ctgcgatggc gtctcggcgg cgcaagcgga ctgctcgcac cacgtctcgc 24241 cgaccggcct ggaactggat atcctccatc gtggtcccag ggctgatctt gtgttcgggg 24301 aaggtctgtt ctagccactc gatctgctga gaggtgaacg tgacaggacg ggccgtaccc 24361 ttgcctgttc tcgatccttc cactgtgggt gacataaccg taggtcggtg ggtcttcata 24421 gtagccatct atcatatctc ctatgctggt tagtctattc tatctagaat ccttcgtagt 24481 catccattct catcttcacc tctcttctac ccggtcttcc ctgaccgctc ctctctcccc 24541 gctccctcta cggggccttg gacggatgca cttgctccta tgtgggtgac ataatccacc 24601 tcagcagaag aacgcccagg agtcccgtac agcctccaga ttcaacgatc ccctccgggg 24661 cggggtagcc tctatcccaa gctgctttgc cagctctacg agcacacagg ggccactgta 24721 catggcgatg aactgctccc gtatgtggac gtgcatccga tccacgtctg ccgcataggt 24781 gcccatgctg tcgtggatgg cctggatcgg gattccctct gccgcgcatg ccaaggccgt 24841 caggcccagg tggctgctgt ccagcccgtg gacgaagttc ggagcgatgc cgttggcgtt 24901 gcgtaccggg tccagctcgt ccttggcctc gtacagggtg acgtactcga cagcctcggc 24961 ccgcagccgc acccggacct cctcggtctt cgggtaggac tgaaagacct gcatgccgag 25021 tggcgtggtc cagtgcaaat ccttggatgc gtcaggaagg gccttagcga gccgctggag 25081 ccattccatg gcgaagactg ccgagggtac tgtctcgcgg attgcgtcca gtatgagcgt 25141 tgccatgtag cttcccaggc ggtatgacgg gataccctcg ggaatctcca gaccagcctc 25201 gtccaggtag tccaggcagt ggtccaccac gcccttgaat gtggtgccgt acaccaacgt 25261 catgcagggt ttcttcgtca ggctccggga taggccggcc ttatcccaca atacagcgta 25321 gccccgagcc tcgccttcag caccctctct gtctcgtgcc agagaccctg caacgagtgc 25381 gagaactcgg gagtagatgt cagctttggt aagtccaggc gggaggaggt tgacgtatgc 25441 tccgccgacc tcatctcgca gaatggctga gtagtgctgg aggccggagc aggttgcatc 25501 catgtggacg atgaatccgc tctggtatcg ctcgggctga cccgatgcgt aggccgcccg 25561 cagttccagc agacctgcga tggcgcacag gggcgactcg tcttccggga agagacccgg 25621 atagttctcc gggccttcgt caagtgctcg ctggaagtcg tcccagcgtt cgtcaaccca 25681 ggccgctcgg tcgtcgaagt acaccttgtc acatccgagg gagttggcga cgtggacctt 25741 gagccagtac aggccgcgct taccgagggc acgcttttcg tggaatcgca gacacgcctt 25801 ggcgatgtcg gacccttggg gattcggtgt gccccaatag tacatgcggc cacgggagtc 25861 aacgtgcatc gggaagtaca ctgccttgcc atgatgctct cgaacaactc gatagagtgc 25921 agcaaactcg cgaagcttgg cggtatgctc ccgctcgccg gtgtaccatc ggtggacgga 25981 tcgcttccag cggttgaagg cttccagctc ttgttcactg gcgttctcct tggcccactc 26041 gtcgccgagc gggaactcag gtttgtccgg gtaggtgcgc tgagggatgc ccagcacacc 26101 accgccggaa gtgaagacgc gctcgatgat ctcgtacacg tcgtggttga tctcgtaggc 26161 cactgattgc agcgcgttga ccgcctcata caccctgggc atcttgtccc ggcccaggtg 26221 gcgtagctgc atctggcgcg cccgcttggt ctggtgcttg gtacggcgca ctagcacatg 26281 gtgcttctgc gccttagcgc tgtagtaacc gccatcgcac cagtcgttcc atggtcgcgg 26341 cggtgccagc atcacgctac ggcctgggcc tccccaggtc atcgccgccg aagggtcttg 26401 caggaactcc ttggcttccg gcgacggctc caggtggacg ctcgtaccgc cccgacctgt 26461 gaagcggttc ggctcgaaca ggccgcactg tatcagcgga tcaccgatga acttgccgag 26521 gcgcaggtag tcgccatccg gcaggtcgat acgtgcctct tccggcagta ccgcgtccag 26581 aagagcgtcc atcgtcttct ggatgtgccg gacgctgcga gtcctgctgg tcttgaggta 26641 gtccagcgtc cggtcgtaat agggttggtt gaccttgaag gccaaccgca cttcgatctc 26701 gcgacagagc atcttaccca tgtgggtgta atacttcgtc gctgtaatcg ttgggtagtt 26761 gatgagcatc gacagcccag cccgcagcgc catgaccgcg aggtcctggg cgtcgatgat 26821 ccgcagcagg tgccggagct tcgctgccgg ccccgccgcc ttcgcttcct ggtgggcgaa 26881 gatcgcttcg gtcacgatgg ggagcatccg catcaacatg atgcgcgccc tcgggatgcg 26941 gtcgatggac ccttgggcaa tcgccttttc caaggcaatg cgggcgtcat tctgcgccgc 27001 cccgaccagg gcctcttcgt gggcgatctg ctgctgtatc aggtccattc cgtctcctat 27061 cgtctttcga ttacgcgccc gatatcctcg ggaccccact cggcctcggc caggctaacc 27121 gccccatcca gcgtcatcgc tcggtagtca cgccattccc cgcagctcag aatctcagcg 27181 cggaaccagc gcagttccac cagcttcact tcccgctcca ggcgctccgc catcccccgg 27241 agaatgtccg gaagtatgac atcgccccag tcccgatggc tgaccatcgc tggcgtgatg 27301 tacgctgtga cgtagttgac cccgatgccc cgctcgttga aggcccagat gacccgaaca 27361 ccttcatcgg tctcgtgcgg tcgggtacac caacagattt tactcattgc ctttctcccg 27421 gtccatcagg gcacgctcgg cggcggccat tgcgttgaat gcctcatgca ccaggtgcat 27481 caggttggac tcgtcatcca gcggcccgtc gatcagccgc ttggactcgt gcctgtgttg 27541 ggcggacttg aactcgccca ccgtcatctt cttccagtcg tgtggcagat accccttgac 27601 ctcggcagcc cattgcatca ttcgagcaag ctcccgcttc agcagcggga acccctcgac 27661 taccaggtgc atgggaagct tgccgacctt gcgttcttcc agactcgcac ctttgcggta 27721 cggttcagtc gtgatcgtcg actcgtaaga gtccgggaat gctaggctca tgctacctcc 27781 ttagttgctc agcagggctt tgcgctgttc cgaggtgttg cgggtgtacc gcccccggct 27841 ccagccacca cagccgccgc agtgatagtg ctcgtacttg ccggtctgcg tatgcaccca 27901 gccctcttgc ttgacatccg tgtcgccgca cttcgggcag cggatggtcg gctcggcgtc 27961 attgaagtac acggccacgt tgggatggcc gacgaaccac gggcgcatca ggatgtacag 28021 ctcctccatc gatcgtacgt cgtcgatgtt gtacaggcgc atctcctccc aggcttccgg 28081 gttgtcctgg aggcaggctg cccacaggtc gaatccgggg aacttgccgt ggaggcgctt 28141 cttgatggtg catgccttgt gggtcatgta ctccagcttg cggctggtga acgcgaattg 28201 ctgcttggcg atgatcaagg tatcgatcac cttgaacggt cgtggcggcg gcatcttgtt 28261 caggaagaac cgggcgttga tcttgggcac gtcgaagcgc ttgccgttct ggacgatgat 28321 gatgtcggct tcgtccagca gcttatgcag ggcgaccagc aggtgcatat cgtccaaggg 28381 atcaccctgg cagtccatgt agatcacctc gtcactgtgc atccacttcg cgcagaacga 28441 caggatggtc cagtcccgct tgatctggtt gaggccaacg ttctgcttcc agagcgacca 28501 gacccaaccc tcgataggcg aggtctcgat gtccaggctc agtaccttcg gaccctggcc 28561 gaccacgttg cccacggcgc cagggaactt gcgcactacc tcggcggcct ttcggcccag 28621 ccagtgcaga gcgcccttct tggcgtacgt gccgcgtgcc ctgctgtcgt gaaagcccag 28681 cttgatgcac cagttgcgga agcactggcg gctcacttcg ccgaagcgcg aatgtctggt 28741 cagatgctcg gcgcccttct tgagacccag ctcgacatag acgttgcgca ggtactcatt 28801 ggtgaattgc ttgcggagtt tgctcatacg ttcctcgcgt tgtgctttgc gacggccatc 28861 gccgccttgc gtttggcggc tgcctgccgg cgcttggcca gcttcgcttc gtgtttctcc 28921 tcgtcggtct tgtgcagggg gtagatcagc ggatgcttcg gcccctccag gtacgtcagg 28981 agggcacgaa ggtaggggat gatgtcggtg tatttcatcg acttgcatcc ccaggaaccc 29041 gccgcgttcg tgatcttgcc ttctgcggtg ttacaggatc gatgcaggac gccccgcacc 29101 agccccgtct cgtggtcgtg gtccatcacc gcctcgccct tcacgctgat atcgatgggc 29161 ttaccgcaga gcgggcatag cttgccctgc tcggcccaca gcttcagggt gaaggtgcgc 29221 tgttggctgc gcggtatctg gtagaccttc ggctcactcg tcatagtcac tctccctccg 29281 cttctggagc agcgcctcgt ggtaggcgtc cagctcgatg atccactggc ggaaggccgg 29341 acgaaggtct cggcttaaca ggtactgcgc tgcgttgtcg gtaggcgttc ggcgcatcca 29401 cagcacctca gcctctgcca gcgggttttg cttgatcttg gcgtaggact ccaggatcat 29461 gtcgatggcc tcgtcctcgt ccgtgatcgg gtggaggata tcgaaggccg tcttcatccc 29521 gcagagctta ccgttgaatc ggtcgattcc tcggatgttg tcagcggtat ccccgccgag 29581 ccactgcgcc aggaagaact tgcgtccgtg ccctttgagc ttgaactgac cggacggcgt 29641 atacgcctcc ttgaggtagc cgaagccccc gtcgatcctg ctcacacacg ctgtatcgat 29701 ctcccaatac gggtagatcg tcatccgcaa gtccttgtcg tcggatcgga tgatggcctt 29761 gtcctgcatg gcgtaggcat ccatcatcat gccgtcatcc gcctcgaaga acgtgtgcag 29821 gataacgtcg atcccttcag gcgccccgcc tcgttcatgc acgtcggcca cagcccgccg 29881 cagcggctcc agcagcgtgg gctttgcctt ccccttgcgc tggccctggt agggtttcat 29941 ggtcggatac acgtcgcggt acgccttggc cccacctgct gccgtgaggt ggacccgtgt 30001 ccctgtacag tgcgccagga actgctgctc cagtatgatc ttccagaatc gccggagcgc 30061 agtgtccagg gtctttgcag tagccgaagc cacgtaggcg ggaccgtcgg cgtcacacac 30121 caacgtcccg cctgccatgg ttcggtcgaa ctgctcggat agtcctgcca ggaactcttc 30181 cgatggcaga cgcattaaac ctgcgggacc gccggcacta ccggaactgc cgggacttcg 30241 accgctgccg gagccgtcac ctgggccacc tgcggcacgt cagggagcac gttctgtgcc 30301 tcggcagtac ctaccacagg ggcagccaca ttcgccacct ggggcacgct gggggccgtc 30361 tgcgccactg cctgcgggac tgccgggacg gcaggggctg ctgctacgcc tgcatcggcg 30421 gccacgttgg gcactgccgg caggttgctg cctgcggcct ggctcgttgg cttgatgatc 30481 agatcgtcgc cgccgcccaa catgatgtgc agggccgagc cggggaagtt ggtggccgag 30541 cgaatggtct cttgcaggaa gttcttggac ttgccgttgt ccgaggtgcc ttcgatgtgc 30601 aaggcgtccc aggtctcctt ggtcggtgcg tcgaagaaga aatactgcaa caggtccatc 30661 ggcagttccg gtacattgta cgggctgcca tcgaccgggt tgtagggttt catgataccg 30721 ccccaatcga tatcgttgcg ttccttgccg gcgttgttgc ccttggtgat cttggtgcgc 30781 ttgatcggga tgatgaacgc ctggccgagc atctgagcga agtgggtatg ctgcccgctc 30841 cagttcatct tgtcgaaggc cagcttggtc ttggactttt cgttgttgcc gagggtcatc 30901 tcgaaggtac ggaacaggcc gggcttgatc gagccgtcgg cctcgtaagt gtggaacagg 30961 tcgtccgggc ggctttgcgg gttaccggcc tgcgggttca cgtcgcccca cagtgcgaag 31021 cccaggcgga tttgaggcgc cgggttcttg agctttccct ggaattcctt ggcgtggtca 31081 cccagctcga tgtagatgca gaagcggccc atggcggtgc ccgccgggaa gatgcgaccg 31141 ccgccaccgc cggtggaggt ttcggacatg tcgatggttg cggtctcggc agccttgttg 31201 gccagggcga gggcggcttg cagagcgttg agttgttgag tcatgcgtgg tctctctctc 31261 gtgtcggatg aagatttaag gccggagtag ggaagggtcg tcaggcgttc ggcagcgtct 31321 tgaagacgat gctcacgctg cgcccatccg cacgggttgt gggtcgaact cggacgttct 31381 tgtagcccag ggtcgccagt atggtttcaa tgctggccac cagtgctgcc gcgctgccgt 31441 ccgggtggtc cacgaacgtc agggtttccc tcggatggga cagcgccatg ccaatggcct 31501 gtagagcaat gccggtggtg cgacccgtac ggcgtactcc cggcaggcac ccggtctggt 31561 ccaggaatgt cttgacgaac tcaggcgtgt gcagcgggtg cagttctttc actggatcac 31621 ctccatattg aacatgttcg gccccatctc agccactgcc gggaacggaa cgtcggcgat 31681 gtcgtagccc aggcgctcgc tcatgtagcg ggcagcgtcg gccatgatgt cgcgcacgcc 31741 cttgttgacc tcggcggcgg tgtccttgtg gcagtcggtg tacacggcat cgtgtacgtt 31801 gttgatcagg aactcggtga ccatgaatcc tgggcgatgc agcatccaac ggaagatgcg 31861 ccctacgctc acggtcatca tgaacccagc ctcgccctgg ttccagtagt tggcgatctg 31921 cgtgtccttg aagtccatga ccgtcttgcg ctgttccttg tcccagcgct cctgttggcg 31981 gaagctgtag caggtgccac ccggcgcttg ccagaatccc cggcggtact ggcgccagtt 32041 gccatccggc cccatctcgc tgaaggcgcc tgccggcatc tggtcctcgg ccttgtacat 32101 gacgaggctg gtggcctctg cactgtcgcg gacgatctgc cggaatgcga tggactctgg 32161 gaacagggcc gcctcgttgt ccaggaattc ctgggcctct tccacggtac agccggtgtt 32221 gaatgcgata ccagccgcac tcgcgccgta ctgcgccgag aatgccttgg gcttgatgtt 32281 ctttcgagcc tgcatcatgc gaccgtgcca cgggtggttg gggtccttct tgatggccac 32341 gagctggtcg tagtcgaacc cgttccagtt gttgtgcttc cctgccaggc ggtacaagtg 32401 catgtcagtg ccggccatca gtttcgccag gaggttccga tccttcgaca gggccgccaa 32461 catcaccacc tccagggcgg tatagtcggt ctcgccgatc atcccgtccg cgccgaagcg 32521 agacacgaac atctccttca cgcggctgcc ggcttccggg tcgtcctcgt ccttcgacgg 32581 gagctgctgg aggttcgggc ggctggacga cagacgcgtt gtcgccgtcg ccgtcgtatt 32641 cagcgaatgg tggatgatgc cgtcgtcgtc cacgtactgg agcatcccct tcgtgtcctt 32701 aatcgtccca tccttgttgt aggtatgggt gatgtagaac gaggagttgt ccttgtgcag 32761 ctcggccagg cgcatcaaca gcttggccgc ctcgaagccc tgtttctcca gagccttgag 32821 ggcgtcgccg ctggtgctga acacgggcga tccatccgcc agggtgaggg cgcactggaa 32881 ctccgggcgt ttgcccagga atttctcacg cactacttcc ggaaggttgg tcaggttgat 32941 caggccgggg aaccggaatc gctggtcatc atcccacttg gtcgccggga tgtccgtatc 33001 ctcccggaac accttgacgc tgcccttgtt cttgccagcg gagaacgtga tgaccgggcc 33061 gtgcttggtc gccagctcgg tgatggtggg ccagtgccac tcaccctggt cggtcacttc 33121 gtggatcggg acccgcactg aggtactctc gattggagtc ccccgcttgg ccgtaccgaa 33181 gcgcacgaag tcggctttct ccatccggcc atcttcgtac ggcacccggc ccttgtaccg 33241 cacctcgcca ccgtagagcc atgcgctcat atggtagagg ctggtatact tgaactcgaa 33301 gtattctggg aagtcgggca tcagcttctt cagctcggcc tcgattccgg ccacctcttc 33361 cagttgcttg gcgtggttca ccttggcgac ttcgaggtcc accttcaggc cggcacactc 33421 catcgccgag aaaccgatca gggcctcgca gcgctccagg tagccagccc acatgccacg 33481 ggcctgaagc ttcatcaact ggccgtagaa cacgagggcg gtattctcga tgtcaccgca 33541 cgggccggac aggtactcgc tcagcaggtc ctggtccatc tccgaggtga gcacaccctg 33601 gtcccacagc atcttgatgc cgtccacctt gtgggtgccg ccgtacttcg gagccagctc 33661 gtcgagtgcc gggtacagcc acgtctgatg actcaacaga tactcggcct gctgggtaca 33721 ccagacccgg ccaccgcgtc gcaggaaggc caggtactcg tcccggtagc gggtgaagaa 33781 ccagttcgat tcgaacatgg cgttgtgagc tacgatcacg tccacgccgt cgaggttgaa 33841 ccagcggttg ttcgggtctt cggcttcggc ccggctgcgg aagcgatgct ctaccttctg 33901 gcctaccttg ccgtcaacgt cgtcacgcca gccggccatg acgatgtagt tgcgggggtc 33961 aaagggcgac gccttgcgcc ccttgtgctc gtgactctcg gtttcgaggt cgaggattcg 34021 gatagtcgtc atttgctgta ccagttgctc tggctgtatt tctgtgcctg gcgcagcatg 34081 ccatccagta cccggcgggg aatctcgttc atcaggtgct ggagcatgcc gtcccggccc 34141 cactgcgaca ggtgcaggat ggggacctcg tgcatgtact ccaggcgacc cagcgtgaga 34201 tgttcgtaac tcacccggag taccagggcg cagatactat ccccccagcc caagggcatt 34261 gtctcggcct ttacacggat accggggaac agcaggttca agggttcgtg gatatctgcc 34321 agcaggcagc ggatcatgcg ttcttcttcg gttggcattc tcatactttg actcctgggt 34381 tactggccag gtcgcggaag cgactgaagc tgggatggcg gagggtgttg gccgagcgct 34441 ccatcgcgga gacctcgacg atacgaccgt agttcggcat ggcctcgtcg atgtgggcgt 34501 tgaggtaggc gcaggtgagg agctggatgt gctcctcgct caggccggtg gcggccacgg 34561 tgccggaacc atcttccagc tccacacggt agcccacgac gcggcccacg ttcttgccag 34621 tcttgcccat cacgtacccg acgatacgcc cgtcaacggt gatctccggc ttgcgcttgt 34681 agcagccagc aaccttgccg ttgcggtagg tcaggctcgg gtctttctcc atcgacccct 34741 cgaagcccat ggcgcggtgg tagccgtacc agcgtagtac cgcctccata gaacggcagg 34801 attgtgcggc tacctggaag aagtacgggg tgtcgccccg ccggcaatct tccatgaggc 34861 tgcggaccat ggcgcggcgc tcatcgtaca cgaggtggga cttgcgcgac ttgcggagca 34921 cgccgatatg ggtggcgtcg aataccgcga agtgcaggca cttcagctcg gccttggtca 34981 gcggggtctt gcgggccata cgcccggtcg cctcactgaa gggcatgcct tccaggtaca 35041 tctcacagtc cagcaccaga ccggagtcca ggccggactg ggacagtttc gcgatgatgc 35101 gatcctccag gccgtccagg gcagggaagc ggcgcccgct gcgggacacc acgccatgcg 35161 caccgacgat ggcacggcac ccgtcgatct taggctcgac gatcacgtac ccgttcttct 35221 tgatgatggc ctcgacggcc ttgtcgttct ggtcaacacc acgccagatg cctttctcga 35281 tatccagtac cacgtcgcgc ttgctcatca cacgttctcc catccgtagt acgcggcctt 35341 ggctcgcatt ttctcgcatc gttccggcag acgtgagcct gcaccgactt ccttgttcac 35401 gccccaggta acgtccttgt gcaggtacgc acccaggcgc gggccgcctt cggggtcggg 35461 ccagttgtac gcaatgccta cctggttgat ggtgaagtcg aacgactcca tcacccggcc 35521 aaggctgtcg gcgtcgtagt agttaaaatc cacgtccatg ccctccaggc cacggcagcc 35581 tacgagggac agcacgccct tgaagatacc gccctcacct gcgttggcgt actcggtact 35641 ccagccaccg tcccggacga agcgcgggtc cagggtagga agcacgctgt tgatgagcac 35701 ttcagcctga tactgcgtca tgccgtacag ggcgatgtcc acgtcctttg gagtggcgcc 35761 atgcatgagg tcgcgaggga acccaccggc cagggcgacg ccctcgttgg gccgtgcatc 35821 agagtacagg cgcagcaaca gggccttgac cccggtcggc agtgcaatgg aacccagtgg 35881 aatttctttg gtgccttcga gcacccggct atgcttagct tgcatggtct acactctcaa 35941 agaagcgaca ccgtgcggcg tcgaagttaa tcatggcctc cacgttcgaa ggcttcccgt 36001 ccatctggaa cttgttcttc ggcagggaca ggccacgcat gacctgttga tccgcaccgt 36061 tgaggcggcc taggtggatt tgcacatcta cagcaccctg caccgctgtc ttcgaatcct 36121 tgagacagga ctgcggtggg aacaactggt cgtgaccgtc gttgctaatc tgccacgtca 36181 tgaagctgat gaagtcgtgg cgcaccgcca tctcgcggac ctcggccacc ttgtactcca 36241 tctcgtcggt gcggttctgg tccttgcgct ggccaccctt gacgtgggcc atcatgtccc 36301 aaaacaccac cgccggcttc atcgcgtcaa tgacctgctc ggcctgggcc agggaccccc 36361 cgtggaagtc cttgatgcgg atcagctcgg agtcgccacc gattttctcg gcgtacatct 36421 tgcgaacctc ttccgggtcc agggcgagaa tctcacccac ggtcataccc agggccgccg 36481 agtacaggcg cggcttgatc cgccgtccct taccctcgtt gttcagccac aggatgggcc 36541 ggcctgggtc gaagtaccgc ttgagctgcg gcgcaatgtg tacggcgatc caggccatga 36601 acgaggtctt gcccgcatca ggaggcgctg ccaccagcac cgaggccccg gcgtggaggc 36661 ccttcatgta cgccggcagc accagccccg gcaacttgat tccgtggtcc ccctgctcct 36721 ccgccaggat atcaaacacg tcgtccgtca catagtcggt cggcgtactg accccctcac 36781 ggcgcagggc ctcgtcgctc agccggcgca gctcatacgc caggtcgatg tcttcgccct 36841 ggttgtactg cgccaggagg gcatccaccc tgcctgaaaa atccagttcg ttgagctggg 36901 acacgactcc ctgtagcgag tccgggtcta ccggcttgtc cagttggttg acaaggttca 36961 ggactaccgc cagttgttcc ggctggtaac cacctcgcag cttgatcagt tcgcgcagcg 37021 cctgcgggtc taccttctga tgcgctgggt agaccttcca gtattgctct atccagtcga 37081 tgacaaagca cgtctccggc cccatcatcc cttcaggcac cacactccgc aacgtgcgga 37141 agcggtcctt gtcactcagt gcgtgtagcg tcaatacgtc caattactag gctccttatc 37201 tgctcgcggg tcaggtcctt ggggtcgaac ccgtccggcg tgtgtattac ttggccttcg 37261 ataagcaggg accggagccg gcgcatcacg cctgcactac cacggacacc tgccgggtcg 37321 ccatccaaga agatgaaggc gcgcttgcag gtctgctgca acatgatcgc cgccagcctg 37381 tcgcgcagcc ttgtaccgtt cagaccgaca gcaaagactt cgggacaggc ccaccgcacc 37441 ttcagcgccg acaagtagtc ttccgtcagc acccatggcc tgcccattga taattcctgg 37501 ggccatccat ggtaatccgg ggcaggatac ccgtagccca cccacttggg attttggtcg 37561 gcagtagcgc gcccaatcca gcccgcgtcg gtagggaaga taagccgatg ctgcctttcg 37621 ctgtacagca gcggcagccc tggcgtcatc acgttgtagt cgatgccctt ggacagcagc 37681 aaaccataga gcgattgata gcagtcggct tgcgtccagt ccgaggcatc ctcgggccag 37741 ggcatgaagc gttcttgatc cgcgcattgc accctccgca catgcgtttt ctcgaccacg 37801 ccaccctcct gacaggagta gcagtatgcc acccagcggt caggaaggtt cttgcaggtc 37861 atgttggtcc ccccccggct catgctctgg catcccagga cgtggcggaa tcgacccacc 37921 tgaccgaccg ccagggattg cgcttgcttt agccaggagt cacggcgcag tgccattggt 37981 accattcctc ccacaaaggc cgcagcccgc ctcgggcctc gaacatgtcc tggaggtgcc 38041 aggtcatgcg ggcgccgtag gcgggccgcc gttgttctgt gtgagcagca cgcccagggc 38101 caccagactg aaggcgactc cgatgaccag cggtttgttc tcgataagcc atgtcatcac 38161 ctcatacgtc atggccgggt gccctcatgt gcagcacgtc cggctctcct gctgtccagt 38221 tcgcctcgcg gtgggtggtg ctccagccca agtcggcgta gaacggctcc aggaactcga 38281 agcaggtcag atactcggca ccagccagct cggcggcccg taccagttca gcgccgatac 38341 cctgcctgct gtgccggtcg tcaacgcaca gggccttcag ctcaccacct actacgaggc 38401 aggaacctac catcaggccg gacaggtcga aggcaccgag ggccagcacg cctcccttct 38461 tgcgccagat gtcgctatct tgccagccat tccggcggag gtggagcaca cactcggcga 38521 tactcgcact cagctccccg gctggactca ggctttcccg gagcgggtgg tacttccgct 38581 gccagaggaa ccactgccac cagttctcgg cgttgctcgg ggcttggatg ctgaatacgt 38641 gaatcgtcct gatttgaatc aggccgggat gcaggttcag cggatacagg ctcgtcttgc 38701 tcatcttcta aatccctcaa cttgcgctgg ccgaagtcaa tcaggtcctg cgccatgtaa 38761 tgcacaaggc tgccggcaca cgccgccacc ttgtcccagg ttgcccgctt accgtcgatg 38821 cacgggaaga cagcctcatc ctccagttca acgccgaagc ggtatccgtt gtaatgcgtg 38881 aagtggtatt gcatgttcgt gatcctccag actcacacga gagggcgctc taggaacgcc 38941 ctcggatttg accccggagt aggccc //